PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00992.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 375aa    MW: 41917.3 Da    PI: 9.2381
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00992.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-5291352128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPtdeelv++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+
  Zmw_sc00992.1.g00150.1.am.mk   9 MPGFRFHPTDEELVSFYLKRKIQQKPISI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSLRPNRVTAAGF 88 
                                   69***************************.89***************9888999*************************** PP

                           NAM  83 Wkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg+d++++s+ +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  Zmw_sc00992.1.g00150.1.am.mk  89 WKATGTDRPIYSSeGTKCIGLKKSLVFYKGRAARGMKTDWMMHEFRL 135
                                   ************956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.2758160IPR003441NAC domain
SuperFamilySSF1019412.09E-549141IPR003441NAC domain
PfamPF023657.0E-2610135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MDKADEIIMP GFRFHPTDEE LVSFYLKRKI QQKPISIELI RQLDIYKYDP WDLPKLASTG  60
EKEWYFYCPR DRKYRNSLRP NRVTAAGFWK ATGTDRPIYS SEGTKCIGLK KSLVFYKGRA  120
ARGMKTDWMM HEFRLPSPTD PSLPKRPIHK NIPLNRGLSH SWGPPFPGAT EAEFFSAFQT  180
VQASELALES SSCSLQPAPP APSSQFTSRH GLQVVFGAQL DHQLHRFVVD SSAEINGDTS  240
SRSQDSSTKK SGNGFSVSNS DWEAVGRINF PFDLGADASE EWRGRLEEIP SAMGRTGLGV  300
DGERTSQIGL IWRSNGLGLV GSSRHLIWAA YAGRSVGDHY RLFLMGRRPV GGNLHLGLTA  360
SWAGYVDGEC REHMG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-481013919146NO APICAL MERISTEM PROTEIN
1ut4_B5e-481013919146NO APICAL MERISTEM PROTEIN
1ut7_A5e-481013919146NO APICAL MERISTEM PROTEIN
1ut7_B5e-481013919146NO APICAL MERISTEM PROTEIN
3swm_A7e-481013922149NAC domain-containing protein 19
3swm_B7e-481013922149NAC domain-containing protein 19
3swm_C7e-481013922149NAC domain-containing protein 19
3swm_D7e-481013922149NAC domain-containing protein 19
3swp_A7e-481013922149NAC domain-containing protein 19
3swp_B7e-481013922149NAC domain-containing protein 19
3swp_C7e-481013922149NAC domain-containing protein 19
3swp_D7e-481013922149NAC domain-containing protein 19
4dul_A5e-481013919146NAC domain-containing protein 19
4dul_B5e-481013919146NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022683500.11e-167protein FEZ
TrEMBLK3YMN31e-169K3YMN3_SETIT; Uncharacterized protein
STRINGSi015514m1e-170(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882