PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00978.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 316aa    MW: 35208.3 Da    PI: 9.0829
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00978.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM136.41.9e-42551881128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkrkn 75 
                                   lppGfrF Pt+eel+++yL+ k++g++ ++++vi+ +d + ++Pw+Lp       ++ a+ + w++F++r++++a+g r++
  Zmw_sc00978.1.g00120.1.am.mk  55 LPPGFRFYPTEEELLCFYLRSKLDGRRSDIDRVIPVADFCALDPWQLPGtaevhrCACAGGEPWFYFCPRQEREARGGRPS 135
                                   79****************************999***************53666654444889******************* PP

                           NAM  76 ratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   r+t sg+Wka g+   v++++g+ +g kkt+vfy+grap g+kt+W m+eyr+
  Zmw_sc00978.1.g00120.1.am.mk 136 RITPSGFWKAAGTPGWVYASDGRPIGSKKTMVFYRGRAPAGTKTKWKMNEYRA 188
                                   ***************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-4850220IPR003441NAC domain
PROSITE profilePS5100547.14355220IPR003441NAC domain
PfamPF023653.8E-2256187IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQPSLRRRVF HLETGNSSRS TPQNDHHLDA STTRTRSPAH SFTVRRRRPP AMAELPPGFR  60
FYPTEEELLC FYLRSKLDGR RSDIDRVIPV ADFCALDPWQ LPGTAEVHRC ACAGGEPWFY  120
FCPRQEREAR GGRPSRITPS GFWKAAGTPG WVYASDGRPI GSKKTMVFYR GRAPAGTKTK  180
WKMNEYRALE DADAADVAAP PPTHALQTRG EFSLCRLYTK SGYPRQFDRR PRAAAMAGGG  240
SEKPAASSST AALLANVEET GRKRKRSPQN DDTSSSDDGS GGRGDCRQHQ PAPEAGTEER  300
LVDATDEWTE FLDWLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-34442206165NO APICAL MERISTEM PROTEIN
1ut4_B4e-34442206165NO APICAL MERISTEM PROTEIN
1ut7_A4e-34442206165NO APICAL MERISTEM PROTEIN
1ut7_B4e-34442206165NO APICAL MERISTEM PROTEIN
3swm_A6e-34442209168NAC domain-containing protein 19
3swm_B6e-34442209168NAC domain-containing protein 19
3swm_C6e-34442209168NAC domain-containing protein 19
3swm_D6e-34442209168NAC domain-containing protein 19
3swp_A6e-34442209168NAC domain-containing protein 19
3swp_B6e-34442209168NAC domain-containing protein 19
3swp_C6e-34442209168NAC domain-containing protein 19
3swp_D6e-34442209168NAC domain-containing protein 19
4dul_A4e-34442206165NAC domain-containing protein 19
4dul_B4e-34442206165NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13547RSPAHSFTVRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025809342.11e-109NAC domain-containing protein 90-like
SwissprotQ9FMR34e-61NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D9WH201e-115A0A0D9WH20_9ORYZ; Uncharacterized protein
STRINGLPERR05G14390.11e-115(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]