PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00956.1.g00190.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 870aa    MW: 95380.9 Da    PI: 9.3607
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                       G2-like   2 prlrWtpeLHerFveaveqLGGse 25 
                                   pr+rWt+ LH++Fv+ave LGG+e 127 PRMRWTTALHAHFVHAVELLGGHE 150
                                   8*********************97 PP

                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePw+Lp+k++ +ekewyfFs rd+ky+tg r+nrat+sg 567 LPPGFRFHPTDEELVTYYLTHKVSDFAFAT-RAIADVDLNKCEPWELPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 646
                                   79*************************999.88***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkg kt+Wvmheyrl 647 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGGKTSWVMHEYRL 692
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-63561713IPR003441NAC domain
PROSITE profilePS5100559.423567713IPR003441NAC domain
PfamPF023653.5E-28568692IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 870 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-5356771320168NAC domain-containing protein 19
3swm_B9e-5356771320168NAC domain-containing protein 19
3swm_C9e-5356771320168NAC domain-containing protein 19
3swm_D9e-5356771320168NAC domain-containing protein 19
3swp_A9e-5356771320168NAC domain-containing protein 19
3swp_B9e-5356771320168NAC domain-containing protein 19
3swp_C9e-5356771320168NAC domain-containing protein 19
3swp_D9e-5356771320168NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number