PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00946.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 177aa    MW: 19774.8 Da    PI: 10.1543
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00946.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.91.1e-32959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++gklyey++
  Zmw_sc00946.1.g00140.1.sm.mk  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSPKGKLYEYAT 59
                                  79***********************************************86 PP

2K-box60.19.3e-21741233685
                         K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                                    hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++ l e+ + lqk  +
  Zmw_sc00946.1.g00140.1.sm.mk  74 EHLMGEDLESLNLKELQQLEQQLESSLKHIRSRKERSLQEENKALQKEVR 123
                                   59********************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-43160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.095161IPR002100Transcription factor, MADS-box
CDDcd002656.80E-39261No hitNo description
SuperFamilySSF554551.96E-31294IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.74652162IPR002487Transcription factor, K-box
PfamPF014864.1E-1673124IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAVIVFSP KGKLYEYATD  60
SRSLAVSGFA ARVEHLMGED LESLNLKELQ QLEQQLESSL KHIRSRKERS LQEENKALQK  120
EVRFLTGSLL AFYPPVTVGE RGEEVVAAAA ALQAQGQAQA QLRVGNLPPW MLSHLNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-19259158Myocyte-specific enhancer factor 2A
3mu6_C1e-19259158Myocyte-specific enhancer factor 2A
3mu6_B1e-19259158Myocyte-specific enhancer factor 2A
3mu6_A1e-19259158Myocyte-specific enhancer factor 2A
1tqe_S1e-19159159Myocyte-specific enhancer factor 2B
1tqe_R1e-19159159Myocyte-specific enhancer factor 2B
1tqe_Q1e-19159159Myocyte-specific enhancer factor 2B
1tqe_P1e-19159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105333.22e-64zea apetala homolog 1
SwissprotQ6Q9I21e-58MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLB6TDJ64e-71B6TDJ6_MAIZE; MADS-box transcription factor 15
STRINGOB07G10630.11e-57(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113