PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00945.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 480aa    MW: 51603.7 Da    PI: 10.0486
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00945.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA498.1e-16176207132
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                                   C++Cg  +Tp+WR+gp g +tLCnaCG++ r 
  Zmw_sc00945.1.g00100.1.am.mk 176 CVQCGKEETPQWRSGPMGRSTLCNACGVRLRA 207
                                   ****************************9986 PP

2GATA50.33.3e-16305339135
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                   C +Cgtt+Tp+WR+gp g  tLCnaCG+++r  +l
  Zmw_sc00945.1.g00100.1.am.mk 305 CLHCGTTSTPQWREGPMGRHTLCNACGVRHRQGRL 339
                                   99*****************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.822170224IPR000679Zinc finger, GATA-type
SMARTSM004015.8E-13170221IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.57E-12174226No hitNo description
Gene3DG3DSA:3.30.50.101.1E-13174214IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.87E-11175225No hitNo description
PfamPF003202.7E-13176207IPR000679Zinc finger, GATA-type
PROSITE patternPS003440176201IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-14298356No hitNo description
PROSITE profilePS5011413.85299335IPR000679Zinc finger, GATA-type
SMARTSM004017.2E-17299353IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.9E-15303337IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.86E-14304351No hitNo description
PfamPF003206.4E-14305339IPR000679Zinc finger, GATA-type
PROSITE patternPS003440305330IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
LTPGRVLSAR SPVAAAAAAF FPSQLIRPPS MATAEGGDGR ELAQPPRLGV PGPGTRRSTA  60
TGDMAVAVAP APAGCGEKEE ERQMEGPQQL YVLGLSVALP LAVAVARLDA GVPRKARTIR  120
PRAEPSDWWT FRMPVPLVKE GKNSPADGKR PVPPEAPRLD AAEQIVEKPA KRAKRCVQCG  180
KEETPQWRSG PMGRSTLCNA CGVRLRAAGA LRETEQRPPP ATPRKVAHPP PPPPESPASD  240
SSPDNPICER RAPIGDIYLV RKQPKSERWS PRKEAAPAPS PAVYLVKKKK PSKKPRKPRN  300
TGQRCLHCGT TSTPQWREGP MGRHTLCNAC GVRHRQGRLL PEYRPAASPT FVPSEHASRH  360
SEVLQLHRQR RTNTQPGLTG DSGDAPESDE DDKNNVVLLR RQPPEKDHCP PTPLHRPLPQ  420
PVDEDPRARG NNGLAVTPVA GCGGGDVVTD VPSSLDSQLL DVRSAPLIVD GDESLVASEP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977277.11e-114PREDICTED: serine/arginine repetitive matrix protein 1-like isoform X1
TrEMBLA0A0A9D6L51e-155A0A0A9D6L5_ARUDO; Uncharacterized protein
STRINGSi010130m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72732646