PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00941.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 213aa    MW: 22716 Da    PI: 9.7941
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00941.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA534.8e-1798129132
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                                   Cs C t +Tp+WR+gpdg+ tLCnaCGl+y +
  Zmw_sc00941.1.g00020.1.am.mk  98 CSRCTTMETPQWREGPDGPGTLCNACGLHYNL 129
                                   *****************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577169.03E-1490133No hitNo description
SMARTSM004011.5E-1192146IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.08692130IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.4E-1496134IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.96E-1397127No hitNo description
PfamPF003201.8E-1498128IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MKGLEDGSLD DPRKGDGEQK GALSAEPASG GALEVSKEDN DVGGLARALR GAAAPAAPPT  60
APGSHETPPA DPSSLEAGGS GTHPMERRRR NRQRNRTCSR CTTMETPQWR EGPDGPGTLC  120
NACGLHYNLD LKRPERRRYG RRRPGPRAQQ PRSRRQRQAS RGAAAEEQAA QQDVQPLRHP  180
ENATVARGPD GPATPAASGT NREIMEGKVA ENP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7139122