PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00938.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 461aa    MW: 49745.5 Da    PI: 9.9108
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00938.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.62.6e-491132382128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y ++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgy
  Zmw_sc00938.1.g00040.1.am.mk 113 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYCFDPWELPARAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGY 192
                                   79***************************.99***************8777899*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Zmw_sc00938.1.g00040.1.am.mk 193 WKATGADRMIRGENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 238
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.066112262IPR003441NAC domain
SuperFamilySSF1019412.35E-57112262IPR003441NAC domain
PfamPF023651.8E-24114238IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MRTRPPTARP GARQPRCPSA PPARPGIWLA LSPSGSFRAA WRMTARAALQ LRQGRLGRVS  60
RCLRAACARY AMSRDLDDWH YGAAGGAAAG SSGESMGGGG EAAGDSHDND LVMPGFRFHP  120
TEEELIEFYL RRKVEGRRFN VDLIADLDLY CFDPWELPAR AVMGGKEWFF YVPRDRKYRN  180
GDRPNRVTAS GYWKATGADR MIRGENNRPI GLKKTLVFYS GKAPKGVRSS WIMNEYRLPP  240
PAADAEPLTH KSEISLCRVY KRSGIDDGRG QPSSSSTQAS AGRRTRAGRH MSTSPASLPL  300
SPIPSSFHLL QGECPSASRP AIIDQMMITA DNVSQLVLPP TARAFAPPGN SLAAVAPAEG  360
ATILASTDSL LNMAAVPTGI SGPVDKLGTV VGDSQAYANH LSAATGSDFL PLPSTQPMPQ  420
VAPLGALPMA APLSSVDDKL SWDWNPVPDT TTRDYRTCIF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-5411426319166NO APICAL MERISTEM PROTEIN
1ut4_B3e-5411426319166NO APICAL MERISTEM PROTEIN
1ut7_A3e-5411426319166NO APICAL MERISTEM PROTEIN
1ut7_B3e-5411426319166NO APICAL MERISTEM PROTEIN
3swm_A4e-5411426322169NAC domain-containing protein 19
3swm_B4e-5411426322169NAC domain-containing protein 19
3swm_C4e-5411426322169NAC domain-containing protein 19
3swm_D4e-5411426322169NAC domain-containing protein 19
3swp_A4e-5411426322169NAC domain-containing protein 19
3swp_B4e-5411426322169NAC domain-containing protein 19
3swp_C4e-5411426322169NAC domain-containing protein 19
3swp_D4e-5411426322169NAC domain-containing protein 19
4dul_A3e-5411426319166NAC domain-containing protein 19
4dul_B3e-5411426319166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-155NAC domain-containing protein 35
TrEMBLK3Z6L91e-153K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m1e-153(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787