PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00906.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 208aa    MW: 23162.4 Da    PI: 10.5017
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00906.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.3e-1572131362
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                   elkr rr+++NRe+A+rsRqRK+++++ L+  v++L+a+ ++L   l+ + +++a+ +++
  Zmw_sc00906.1.g00180.1.am.mk  72 ELKRKRRMESNRESAKRSRQRKQQRLDDLTSQVDQLSAKKQQLVTALNIIVQNYAAAEAQ 131
                                   79*****************************************99999888888776666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-1166116No hitNo description
SMARTSM003384.9E-1470134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.73772135IPR004827Basic-leucine zipper domain
PfamPF001703.4E-1272121IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.06E-1173125No hitNo description
CDDcd147021.77E-1575126No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MLQILSEVLL SGFMVSSTLR RGSHLVLSFS VVFLYWMSLS GGTFSSGTSS GSSLGTRSCG  60
PESDMELQAR MELKRKRRME SNRESAKRSR QRKQQRLDDL TSQVDQLSAK KQQLVTALNI  120
IVQNYAAAEA QNSVLRTQMM ELQSRFRSLR EILYQMNANQ LTNAAAPSTH PSTIFSAASG  180
FNPFGAGAWS SGMQMVQQPV DQLLYQCF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18691KRSRQR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822603.11e-86bZIP transcription factor 44-like isoform X1
TrEMBLA0A1E5VMU62e-89A0A1E5VMU6_9POAL; Uncharacterized protein
STRINGSb07g015450.12e-79(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276