PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00900.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 193aa    MW: 20562.2 Da    PI: 10.4331
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00900.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP65.21.4e-20149193448
                                   STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                           SBP   4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                                   +++C a+l++ak+yh+rhkvCe+h+ka vv+v+g++qrfCqqCsr
  Zmw_sc00900.1.g00200.1.am.mk 149 ADRCGANLADAKRYHKRHKVCETHAKAHVVIVAGRQQRFCQQCSR 193
                                   689*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114117.512144193IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.1E-19149193IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-18149193IPR004333Transcription factor, SBP-box
PfamPF031106.5E-16149193IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MWFLYTYSRT AYAHVPRHGT GPHVRAVSTH VARWQDLFIS LSPFFPTAPA SSRPPSAHEH  60
ELKATAAPAP PRQPAGSYPS SPSTAPPPPP NLATMDRRDR TRRSTSAAAS MAALAAAAAA  120
GEGVENGTAT AMAEDMNTPT LLTGAASGAD RCGANLADAK RYHKRHKVCE THAKAHVVIV  180
AGRQQRFCQQ CSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A7e-16150193952squamosa promoter-binding protein-like 12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6077822