PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00881.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 927aa    MW: 102135 Da    PI: 9.9112
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00881.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM35.72.5e-113683149
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                                  lppGf+F P+de+lvv++L++k+++ +++  ++i++v +++++Pw+L++
  Zmw_sc00881.1.g00060.1.am.mk 36 LPPGFHFFPSDEDLVVHFLRRKAANVPCRP-DIIPTVLLHRYDPWELNA 83
                                  79*************************999.99**************73 PP

2NAM42.22.5e-138413774128
                           NAM  74 knratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   + r+  sg W++ g d++v++ +g  vglkkt++f +g+  kg kt+Wvmhey+l
  Zmw_sc00881.1.g00060.1.am.mk  84 QGRTSPSGCWNTIGADETVTC-SGCSVGLKKTFIFCTGEPFKGFKTNWVMHEYHL 137
                                   568889***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-3532144IPR003441NAC domain
PROSITE profilePS5100515.65336170IPR003441NAC domain
PfamPF023654.3E-1537137IPR003441NAC domain
SuperFamilySSF550211.09E-11540617No hitNo description
CDDcd048958.83E-35543613No hitNo description
Gene3DG3DSA:3.30.70.2606.2E-5544609No hitNo description
PROSITE profilePS5167110.386545624IPR002912ACT domain
SuperFamilySSF550212.16E-12634712No hitNo description
Gene3DG3DSA:3.30.70.2605.7E-16636705No hitNo description
CDDcd049257.64E-34638711No hitNo description
PfamPF018422.1E-8639703IPR002912ACT domain
PROSITE profilePS5167110.448639724IPR002912ACT domain
SuperFamilySSF550219.58E-13817888No hitNo description
Gene3DG3DSA:3.30.70.2603.8E-16818894No hitNo description
PfamPF018426.6E-8821879IPR002912ACT domain
PROSITE profilePS5167112.436821898IPR002912ACT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0016597Molecular Functionamino acid binding
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MRKANPKGGG WLGLETGWGS DEGRADHIRM GGATNLPPGF HFFPSDEDLV VHFLRRKAAN  60
VPCRPDIIPT VLLHRYDPWE LNAQGRTSPS GCWNTIGADE TVTCSGCSVG LKKTFIFCTG  120
EPFKGFKTNW VMHEYHLLDG GGYNASGGST SSSSSVQQLG DMPSLRIKLR RATGVAPPNG  180
RLFLSSRWSA EGAVENVKWR AHSGRRVLLG RPIRLARHPF ASISPTPFAP VPVFFFLVRC  240
RNTASQSLLD RSASQRGEDR ELGGGRASDR RDRSGDDARG TRTESKTLND WIGVARARGR  300
GGRSGGARRL RRCVCLSAAA DFCSGAELLL LRWIGKAGVP PARWRLTRTV RECANVMSPS  360
QGLGEKFMVL VKWRLGSLDD GWTRGCERSK TTRSRGSSIH TTLNPIERKV IAGAQAGSVK  420
AFGITFRPRP HPVALTWFQI HFRWLLRDLN PAPRFYREPH MFLHIYVIGY CTWLLARRRV  480
VRAKEGSCAG ELRGHLKGES GESGRVHRRL AKMLPYFDPE YENFNQRINP PRVCIDNSTC  540
SDCTLVKVDS MNRNGILLEV LQVLSDLDLH ISKAYITSDG GWFMDVFHVV DKQGQKVTDQ  600
KTIQYIDKAL GPESNLLGAK GSSSPGRSVG LHSIGDHTAI ELKGPDRTGL LSEVFAVLAE  660
LECNVLAAEM WTHRTRVACV VYVNDVATGQ AIDDPRRLSR VEDRLRYVIR GYGGGDDALG  720
ALASFSVGPT SHVDRRLHQL MHADVDAADG EAAADVGEGD RPIVTVEHCV EKSYSVVNVK  780
CRDRSKLLYD IDGKTLLKDE AEKVIRCLEA AISRRVSEGF TLELCGRDRV GLLSDVTRVL  840
REHGLTVTRA DVTTVGQQAM NVFYVRDPSG KPVDMKTIEG LRGEIGQTVM LNVKRVPAAT  900
AKTPEPAGGM ARTSFFSFGN LFAKLRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-213514616151NO APICAL MERISTEM PROTEIN
1ut4_B3e-213514616151NO APICAL MERISTEM PROTEIN
1ut7_A3e-213514616151NO APICAL MERISTEM PROTEIN
1ut7_B3e-213514616151NO APICAL MERISTEM PROTEIN
3swm_A3e-213514619154NAC domain-containing protein 19
3swm_B3e-213514619154NAC domain-containing protein 19
3swm_C3e-213514619154NAC domain-containing protein 19
3swm_D3e-213514619154NAC domain-containing protein 19
3swp_A3e-213514619154NAC domain-containing protein 19
3swp_B3e-213514619154NAC domain-containing protein 19
3swp_C3e-213514619154NAC domain-containing protein 19
3swp_D3e-213514619154NAC domain-containing protein 19
4dul_A3e-213514616151NAC domain-containing protein 19
4dul_B3e-213514616151NAC domain-containing protein 19