PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00868.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 888aa    MW: 97428.2 Da    PI: 7.2304
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00868.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP68.41.4e-21178225148
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                                     +Cqv++C+adl++ak+yhrrhkvCe+hsk++++lv++++qrfCqqCs 
  Zmw_sc00868.1.g00150.1.sm.mkhc 178 MCQVDDCRADLTSAKDYHRRHKVCEIHSKTTKALVANQMQRFCQQCSS 225
                                     6*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.3E-23172225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.7176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-21177225IPR004333Transcription factor, SBP-box
PfamPF031102.7E-15179226IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 888 aa     Download sequence    Send to blast
MQREVGPQVA PPLFLHQIQQ LPPHAAAAKK RGHPWPAGPP ANKPAVVADA GAGAGNWNPR  60
MWDWDSRSLT ARPSSDALRL GSGAGQSQPQ PAARAAEASR QGSGALNLQL GLRKDGATAM  120
DTTGSAPMAA ASSPPPCAAA GQEPVVRPSK RVRSGSPGSV AGGSVGGGAA NGGGSYPMCQ  180
VDDCRADLTS AKDYHRRHKV CEIHSKTTKA LVANQMQRFC QQCSSVDDDI RPKTDSANKY  240
LSSESSNPLD ERSPSSSPPI TRKFFPIHSV DEVVRHPQAA DYGEDPAMIE VSTSRAWCAP  300
PLELFKDSER PIENGSPPNP GYRSCYASTS CSDHSPSSSN SDGQDRTGRI IFKLFGKEPS  360
TIPGNLRSEI INWLKHSPTE MEGYIRPGCL VLSMYLSMPP IAWDELEENL LQRVNALIEG  420
SGVDFWRNGR FLVRTDTQLV SYKDGMTRLS KSWRTWNTPE LTFVTPIAVV GGKKSSLVLK  480
GRNLTIPGTQ IHCTNMGKYI SKQVLCSAYP GTIYDDSGVE TFDLPGEPNL TLGRCFIEVE  540
NRFRGNSFPV IVANSSVCKE LRNLEIELED SQFHDVSLDD QVHDHRQSKP RDQALHFLNE  600
LGWLFQRAAA CTPSTRSDVC DSDLIQFSTI RFKHLLLFSS ERDWCSVTRT LLDILAKRSF  660
VSEEVSQETL EMLSEIHLLN RAVKRKSSCM VHLLVQYVVM CPDNSKLYPF VPNLPGPGGL  720
TPLHLAASIE NAEDIVDALT DDPQQIGLSC WQSVLDDDGQ SPETYAKLRN HNSYNELVAQ  780
KLLDRKNNQV TIMVSKDDIL VEQLGNDGDY NKSGAQALQI RSCSQCAILD SGVLRLPLRS  840
RGLLARPYIH SMLAIAAVCV CVCVFMRALL RFNSGRSFKW ERLDFGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-20174224151squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021320166.10.0squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLA0A1B6PIZ00.0A0A1B6PIZ0_SORBI; Uncharacterized protein
STRINGPavir.Fb01917.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853