PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00846.1.g00230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 239aa    MW: 25078.4 Da    PI: 9.9044
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00846.1.g00230.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.41.5e-081511932163
                                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     R RKk+++ e ++ v +L+ eN+aL++e++ l+k + +l +e+
  Zmw_sc00846.1.g00230.1.sm.mkhc 151 RPRKKMRLPEIQQMVRSLSVENDALRQEMKALQKACTALSKEN 193
                                     89*************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-5151190No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MTAAVDVEPC ALVATAADII CSFRASDLAG WTPPWRKRPD PPALDDDAAD AXXXXSCSPS  60
ASAGSGSAGA RKTKKKEARR ARGSPPSPLD YSAGSGASTS GGEDGAFCSP PPPVLSSIGG  120
VLQVDPVNSK VGLAGRRSIP PVPPPRPTGQ RPRKKMRLPE IQQMVRSLSV ENDALRQEMK  180
ALQKACTALS KENGKLETRL HQLNKRQEKK GKLQAGQGAT EEAQNGFALP DLNLPAHDG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150156RPRKKMR
2204211KRQEKKGK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025811831.12e-68collagen alpha-1(I) chain-like
TrEMBLA0A3L6PC001e-68A0A3L6PC00_PANMI; Uncharacterized protein
STRINGGRMZM2G050912_P016e-58(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951