PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00840.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 483aa    MW: 52285.2 Da    PI: 7.9837
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00840.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52521801128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat
  Zmw_sc00840.1.g00170.1.am.mk  52 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQEkcRIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 131
                                   69****************************.9***************952444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk+++s  ++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc00840.1.g00170.1.am.mk 132 AAGFWKATGRDKAIYS-CTRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 180
                                   ****************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5346182IPR003441NAC domain
PROSITE profilePS5100551.41152283IPR003441NAC domain
PfamPF023651.0E-2753180IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MVPLRLSLAL FRMPRLLPLI VYLPLSPRFF LPGPDGGDHP PRSRPIALLS AVPPGFRFHP  60
TEEELLTYYL KKKVASERID LDVIRDVDLN KLEPWDIQEK CRIGSGPQND WYFFSHKDKK  120
YPTGTRTNRA TAAGFWKATG RDKAIYSCTR RIGMRKTLVF YKGRAPHGQK SDWIMHEYRL  180
DDVQTPAAGV DPYYPSPPPP PPALELGLGV PGLLVEISMA GGEVVGLGSP WKATEFAHQQ  240
DHQTCVSKGQ PKTAGRVRMR GGAAAGDQAA QEEGWVICRV FKKKNLVLHH GQSSGGGGTT  300
TVATAASKTA AATTMESSPT SNGSSVTVTD QVKAQLLHSA SDDALDHILQ YIGRSYHTNN  360
EQDTKPPPAL QLDHHLAATT ATACPAGSSF YGRFMKLPPL EHVGAGLLPN PAGYAADASG  420
IADWDSLDRL AAYEFNGLSD ASKNMVAFLE EPNAAAGTGD GDLWSLARSS VSSLHPDLTM  480
NNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-435218015140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436417.11e-152NAC domain-containing protein 43
TrEMBLQ5NKS71e-151Q5NKS7_SORBI; Putative NAM (No apical meristem) protein
STRINGSb10g002120.11e-152(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112