Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00834.1.g00100.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Protein Properties Length: 256aa    MW: 29001.8 Da    PI: 8.8906
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                                  79**********************************************95 PP

                         K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                                   ++++  ++++s++qe++kL+++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke+  78 DTNNPLSESQSWYQEMSKLRAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALTQARQRKTQLMMEQVEELRRKERH 158
                                   455566788************************************************************************ PP

                         K-box  87 lqeenkaLrkkle 99 
                                   l e n++L+ +l+ 159 LGEMNRQLKVQLD 171
                                   ********98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
CDDcd002653.65E-46275No hitNo description
SuperFamilySSF554551.7E-33281IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-333859IPR002100Transcription factor, MADS-box
PfamPF014863.6E-3084170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.3886176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D5e-228817419104Developmental protein SEPALLATA 3
4ox0_C5e-228817419104Developmental protein SEPALLATA 3
4ox0_B5e-228817419104Developmental protein SEPALLATA 3
4ox0_A5e-228817419104Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953459.11e-163PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU391e-147MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLK3YV641e-163K3YV64_SETIT; Uncharacterized protein
STRINGSi018160m1e-162(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number