PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00800.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family YABBY
Protein Properties Length: 78aa    MW: 8776.83 Da    PI: 9.9196
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00800.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY38.63.8e-12257191137
                           YABBY  91 sastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeei 137
                                     s+s++ +  ++ + +++ ++++  + r PekrqrvPsaynrfi   i
  Zmw_sc00800.1.g00070.1.sm.mkhc  25 SSSAKFRLPMMYSAQNDLLQEQALAARAPEKRQRVPSAYNRFINGHI 71 
                                     3444555555555555555555669******************9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.6E-102371IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
ENIRPQGTIN GTSRDQFDHL EFGSSSSAKF RLPMMYSAQN DLLQEQALAA RAPEKRQRVP  60
SAYNRFINGH IIQTSILG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442565.12e-24hypothetical protein SORBIDRAFT_08g022030
SwissprotQ2QM171e-12YAB6_ORYSJ; Protein YABBY 6
TrEMBLC5YSF32e-24C5YSF3_SORBI; Putative uncharacterized protein Sb08g022030
STRINGSb08g022030.15e-24(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121