PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00791.1.g00340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 867aa    MW: 97177.3 Da    PI: 6.3796
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00791.1.g00340.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.87.4e-52121431128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknra 77 
                                   lppGfrFhP+d+elv +yL +k++gk           + +vd++k+ePwdLp+++  +++ewyfFs +d+kyatg+r+nra
  Zmw_sc00791.1.g00340.1.am.mk  12 LPPGFRFHPRDDELVLDYLYHKLSGKGggggAYGGINMVDVDLNKCEPWDLPEEACVGSREWYFFSLHDRKYATGQRTNRA 92 
                                   79************************988753333459999***********87777899********************* PP

                           NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   t+sgyWkatgkd+++ +++g++vg++ktLvfy+grap+g+kt+Wvmhe+r+
  Zmw_sc00791.1.g00340.1.am.mk  93 TRSGYWKATGKDRPISRRRGAVVGMRKTLVFYQGRAPRGRKTEWVMHEFRV 143
                                   *************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-562169IPR003441NAC domain
PROSITE profilePS5100554.95712169IPR003441NAC domain
PfamPF023652.7E-2513143IPR003441NAC domain
PfamPF033431.2E-13642810IPR005011SNU66/SART1 family
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000398Biological ProcessmRNA splicing, via spliceosome
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 867 aa     Download sequence    Send to blast
MMSSISMVEA RLPPGFRFHP RDDELVLDYL YHKLSGKGGG GGAYGGINMV DVDLNKCEPW  60
DLPEEACVGS REWYFFSLHD RKYATGQRTN RATRSGYWKA TGKDRPISRR RGAVVGMRKT  120
LVFYQGRAPR GRKTEWVMHE FRVEGPAIAD AVAGSPLTED WVLCRVFYRS RTVTTRPAPA  180
DVEAGSLANE LITLPMPHAP PVDAYLLALD HAPAATIGGF YYQQDDDGGL PAAQGKTLSN  240
FRELLTSMVE RDGGAAAKPE LHQHHHHQDW TEAAYAAQQS AVAAQAWNPF LNSGSRNLPV  300
TEAGAEPVSK GIPSPAARSS RFAASAVPPP GSPVFARVRP LLVSPALGCQ QLPPFPSKPP  360
AQAFGTVVSI CALLRGVAAL NVEVSLVRII GDSLHCKTSS FCVLVPRQFG GSRDSPERSI  420
GWAGIRVSSM NRPSSCMEVD VGERHRDKER RERPKREEKD HHGSGRSDRD REKDKDDRRR  480
EKDESRHRDR DRERDREKDG KPRDRDKEAE RDRVRDRDRG KDREREPERP RDKDRGKDRD  540
REPDRDKERD RRDRDKERSR NRDREKDKAE RVERERDDRE REKLRGKGHV EDEADLSKGH  600
EGDQNAQGEV EQASTAELRE RIARLTQLAV LLLATFGKCA EEEELVFGDD YEDLQKSLEQ  660
ARKLALRKQE EPAASGPLAV VEMATANKGE EDADATERDV QQNKVVITEM EEFVWGLQLS  720
EESRKPEAGD VFMDEDDDAM PSDSPAKDDT NGLAPMEEET LQNEKSVTNE EEEVKPDDVI  780
HEVAVGKGLA GALKILKERG SLNEGTDWGG RTTDKKKSKL VGIEDGPKDI RIERLDEFGR  840
VVEHFLGIKR SAKSGSLPPP APKRPKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-44916712166Stress-induced transcription factor NAC1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1443452RHRDKERRER
2449456RRERPKRE
3485497RHRDRDRERDREK
4529534PRDKDR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138