PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00790.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GeBP
Protein Properties Length: 365aa    MW: 39651.3 Da    PI: 7.2237
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00790.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57386.43.8e-2776170297
                        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfsk 82 
                                   +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+ +++++++g +p+  +
  Zmw_sc00790.1.g00100.1.sm.mk  76 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSMSARVAKGLDPARLA 155
                                   79*******************.556878888************************************************** PP

                        DUF573  83 ehdqkifelskkiWg 97 
                                   +hd+++++l++++W+
  Zmw_sc00790.1.g00100.1.sm.mk 156 PHDRDVLHLCSRLWD 170
                                   **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-2477170IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MASEDQQTLP VPVPVPVPVP PNPTATPTAP ADPTAPSGAR KLPIKRRSPR PSSSSPPSSG  60
SDQQQEQEQE PQPPFKFQRI WSESDELRFL QGLLGCGAQG LVFPRDLNVF YDRFSESMPQ  120
PYTRSQLSEK LRRLKNKFRS MSARVAKGLD PARLAPHDRD VLHLCSRLWD PANAATSPFA  180
ASAGTGASGN RRRRANPHGT LQSPDAPGDS NTNRFNGISF PDGSNCEDMF FIEQESGHLG  240
NHEGASLVAD STFSGIALEQ PQTTAAVPIG DHGLVSEMNG NHKLVVPCSS EHRMANAVLD  300
VFEECLREAK ANGIFRGGNA KGSASESELT KRWRAQRMDE LDVLNRRLRL LVEDTAAAGN  360
MPSSL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.11e-165uncharacterized protein LOC100276272
TrEMBLB6T7U51e-165B6T7U5_MAIZE; Putative uncharacterized protein
TrEMBLF1DK221e-165F1DK22_MAIZE; GEBP transcription factor (Fragment)
STRINGGRMZM2G041818_P011e-164(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243