PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00781.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 338aa    MW: 36781.8 Da    PI: 6.7212
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00781.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.31.9e-14143197357
                                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                      lk+ rr+  NRe+ArrsR+RK+  +  Le  v  L+aeN +L k+l  ++++++
  Zmw_sc00781.1.g00200.1.sm.mkhc 143 NLKKMRRMLANRESARRSRRRKQIHLNDLESQVSMLTAENASLLKRLVDMTEKYK 197
                                     68***************************************99977766666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-14141205IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.829143195IPR004827Basic-leucine zipper domain
PfamPF001702.8E-13143197IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-12145197No hitNo description
SuperFamilySSF579592.32E-11145195No hitNo description
PROSITE patternPS000360148163IPR004827Basic-leucine zipper domain
PfamPF124983.2E-19213318IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MPFPVRIPPP RARMLPLGGC EARQKSGSFP RTAGFSGDEV AEVGCSYAAA LKRELDLYCA  60
AVAKSMDAKS QESSLGYPNS QASASSELIS QASFHGDRDG ASLFINSHII DNADSQGMSA  120
NTGILKEQSG DGDDLEEITN PANLKKMRRM LANRESARRS RRRKQIHLND LESQVSMLTA  180
ENASLLKRLV DMTEKYKDAT FDNQNLIVDL AMMRRKVHIA EEAVRVTGAS MLLPPTTSDM  240
PVSSMPLTSC ASDAASLAVP VQENMHPFLQ QPLIHGNQFK LDLPNATISL SSREMITMAV  300
SLRGVASMEN LQKRIHKDSV HSGTALPLSD PEALNDDK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157164RRSRRRKQ
2159164SRRRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805357.11e-123light-inducible protein CPRF2-like
TrEMBLA0A2T7EIZ51e-122A0A2T7EIZ5_9POAL; Uncharacterized protein
STRINGPavir.Cb00258.1.p1e-116(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943