PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00778.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 540aa    MW: 58462.1 Da    PI: 6.1496
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00778.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1292.3e-09223281563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l +++
  Zmw_sc00778.1.g00280.1.am.mk 223 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQN 281
                                   999******************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16219283IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714221284IPR004827Basic-leucine zipper domain
PfamPF001706.9E-9223281IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-10223273No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-8223280No hitNo description
CDDcd147039.09E-24224273No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MNGAANGHGM VHHHLHHHAQ ASAPLPTAFP LPAQHHQQQQ QGAGGGSKQR PGLPPTPPGF  60
HAVHADTEAG GGGWCLPGAG GDDLFNAYMT SMEGVDAGGL KYCSDGESRG SSMRTNGADS  120
SENESEDYGG ADSQFLVWGD GAGKKREGVK RNAAGEPAAS PAAGRHARSL SMDSLMGKLS  180
FSANGEPAGK FSLEFGGGEF TPAEMKRIMA DEKLAEMALA DPKRVKRVLA NRQSAARSKE  240
RRMRYIAELE QKVQILQTEA TTLSAQLTLL QRDSSGLATQ NNELKFRLQA MEQQAQLRDA  300
LNEALSAEVH RLKVGDANSS SNLPKQMQLH YQSQMHELHK QQQGEQIPFY QLEQREQNGR  360
PTGTAVCWWQ CDALDGEKWQ SEREGLGRNT GTATEHGFDV ANRVATRERV VLPIRELMDA  420
PTLAMSVRAT CAMPAWARDR RTGLVTSQHL DEPPSAPLGA GSAAPRPYRH MPPVKTTSTR  480
SGLLGHHSVL LWAMGFDDEL EGEEVESVAS KELTEDCYGD NSCSETANED DMLLLIPTCC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.11e-148transcription factor RF2b
TrEMBLA0A0E0MA281e-144A0A0E0MA28_ORYPU; Uncharacterized protein
STRINGOPUNC10G15060.11e-144(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576