PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00769.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 404aa    MW: 43072.8 Da    PI: 8.6108
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00769.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.6e-32265320156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zmw_sc00769.1.g00010.1.am.mk 265 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 320
                                   68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.46E-17262323IPR009057Homeodomain-like
PROSITE profilePS5129413.69262322IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-28263323IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-26265320IPR006447Myb domain, plants
PfamPF002498.1E-7267318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MSSSSPSDLT LDYKPNGGAY AAIPKQQQAP PLVDGHHLTT EPASQKLREF LARLEEERLK  60
IDAFKRELPL CMQLLNHAME AYKQQLEAYQ MGSQQAVATR PLVLEEFIPL KNIGIDAVTD  120
KPGNPPSEKA TWMESAQLWN GPAADTAAKG PQTPKERSEH PLPIDTLGTL DGRRSGGGGG  180
AFLPFAKDKS AVPGAATALP ELALAPAEKD AVAEVDRKPP YLDAGGGGNN GVLGALRDTQ  240
NGGVKPTSAA PEGQASPAPP QTHRKARRCW SPELHRRFVN ALQILGGAQV ATPKQIRELM  300
KVDGLTNDEV KSHLQKYRLH TRRPPAPPNP ATAAPQLVVL GGIWVPPEYA AQGAAPAIYG  360
AHPATQPHYT AAVAAQEYYP SPAAVHHLQH HPATAMLHRA AAAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14265318154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14265318154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14265318154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14265318154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14265318255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819732.10.0transcription factor NIGTH1
SwissprotQ5VRW21e-143NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A3L6SLE00.0A0A3L6SLE0_PANMI; Putative transcription factor GLK2
STRINGSb03g004090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]