PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00765.1.g00190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 249aa    MW: 26674.9 Da    PI: 8.8265
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00765.1.g00190.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.13.4e-17176227354
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                                   +++r +r++kNRe+A rsR+RK+a++ eLe++vk L++eN++L+ + e+l+ 
  Zmw_sc00765.1.g00190.1.am.mk 176 SDRRKKRMIKNRESAARSRARKQAYVRELEKEVKLLQQENQSLRVKYEQLRV 227
                                   689******************************************9999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-13174243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.99176226IPR004827Basic-leucine zipper domain
PfamPF001702.3E-15177228IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-12178227No hitNo description
Gene3DG3DSA:1.20.5.1707.1E-15178229No hitNo description
CDDcd147073.77E-22178225No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDLGQENEPA SRAPLWPCGA PLRAQNKQGE RSPTDRAPFG VMAAMDMDDD EDIWANSPSP  60
SASPPRSAAC GFISTQLSLN SHLHLLSSSA ADAGGVHGGS PTDHSVGDGI FAAYGGFRHQ  120
AGVSGGFRNA AASSFFPYGV DAVPAPYDSD AARSALEHEM CLGPAAATWA GSVAGSDRRK  180
KRMIKNRESA ARSRARKQAY VRELEKEVKL LQQENQSLRV KYEQLRVSVE VPVPTPVKKT  240
LRRMPSAPF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957504.19e-80ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLK3ZWU52e-78K3ZWU5_SETIT; Uncharacterized protein
STRINGSi031077m4e-79(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044