PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00763.1.g00370.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 321aa    MW: 35865.6 Da    PI: 5.9914
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                     pGfrFhPt+eel+++yL   v+gkkl++ ++i +++iy+++PwdLp+++k +e+ewyfF++rd+k+ +g r+nr+t++g  13 PGFRFHPTEEELLDFYLDSVVHGKKLNF-DIIGTLNIYRHDPWDLPRMAKIGEREWYFFVPRDRKAGSGGRPNRTTEHG 90 
                                     9*************************99.99***************988999*************************** PP

                             NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +Wkatg+d+++ s+   ++++glkktLvfykgrap+g+ktdWvm eyrl  91 FWKATGSDRAIRSSadAKRVIGLKKTLVFYKGRAPRGTKTDWVMSEYRL 139
                                     ************99777888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.11E-554166IPR003441NAC domain
PROSITE profilePS5100553.69711166IPR003441NAC domain
PfamPF023653.4E-2413139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-47716610168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795753.11e-166NAC domain-containing protein 22
SwissprotQ10S651e-138NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3L6S6V01e-166A0A3L6S6V0_PANMI; NAC domain-containing protein 67-like
STRINGPavir.J24394.1.p1e-161(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4