PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00763.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Nin-like
Protein Properties Length: 749aa    MW: 83936.9 Da    PI: 4.9856
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00763.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.6e-28601651252
                          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                     ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Zmw_sc00763.1.g00200.1.sm.mkhc 601 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 651
                                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.631590671IPR003035RWP-RK domain
PfamPF020423.4E-26603651IPR003035RWP-RK domain
PROSITE profilePS5174515.551643728IPR000270PB1 domain
SMARTSM006664.7E-7646728IPR000270PB1 domain
PfamPF005647.0E-11661719IPR000270PB1 domain
SuperFamilySSF542773.6E-14661718No hitNo description
Gene3DG3DSA:3.10.20.2403.1E-14664719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MEQKEEDGFL GCGTRMEEEI VVGDMDLMEE LFLAAPGFDF SDFPNPGAGA SPAAAAAFSP  60
LFDICSTTTT ATPPPAQAGE DDREEPAEKA DREGANTPLR PWLFQPRQQE VEATVKERLR  120
RALERIASLS QSQPGELLAQ VWVPMVIGDR QVLTTCGQPF WLDRRNERLA SYRTVSMKYQ  180
FSADESSRAE LGLPGRVFVG RVPEWTPDVR YFSTEEYPRV RHAKHFDIRG SVALPIFEPR  240
TRACLGVVEL VMTTQKINYN AEIENICSAL KEVDLRSTDG SSDPFAKVVD TSYRAILPEI  300
ADVLRTVCER HKLPLAQAWI PCISQAKRGS RHSDEKFCVS TVDEACYVQD PDVRGFHEAC  360
SEHHLFREGV VGRAFGTNEP CFCPDITAYS KVEYPLSHHA KLFNLRAAVA IRLRSVGTGS  420
LDFVLEFFLP VDCVTDEEQR AMLNSLFVTI QQTCCTLRAV SLKELVDEGS IETNLPTQQE  480
FYDNSMHENL GELCSGVDVP ARTTSLENSE VSSWIASLVD AQNKGVKEID GDLPFGFTKH  540
EDEGFSVTAG WNTSPVLGPE DSIFSGFKHH EEYEVKEANC SSPPNTLNLE KTVEKRRTKT  600
EKTVSLEELR KHFAGSLKEA AKNLGVCPTT LKRICRQHGI NRWPSRKIKK VGHSLKKLEM  660
VIDSPSWGFD KLKEEILRRF SIAKENYVDL KYLDDESEWV LLTCDADLLE CIDVYKSSSV  720
QTGTCDVGLI KHVKIKFIMA TFDQASQNQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698190.10.0protein NLP1 isoform X2
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A2T7CI590.0A0A2T7CI59_9POAL; Uncharacterized protein
STRINGSi034133m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]