PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00758.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 804aa    MW: 88883.4 Da    PI: 6.4335
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00758.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.58.2e-1094237941373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zmw_sc00758.1.g00210.1.am.mk 423 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 500
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N +I +a  g++++Hi+D++i +G+QWp++l++++ R++gpp++ iTg++ p++g   +e++ee
  Zmw_sc00758.1.g00210.1.am.mk 501 QLYMAAICFKKVAFIFSNYTIFNASLGKKKIHIVDYGIHYGFQWPCFLKQISGREGGPPEVTITGIDLPQPGfrPTERIEE 581
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL+++A+e+gvpf++++++a+++e+++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd vL+ +++++P+ +++
  Zmw_sc00758.1.g00210.1.am.mk 582 TGRRLSNYAREFGVPFKYHAIAASKMESVRKEDLNIDPDEVLIVNCMYQFKNLMDESVVIESPRDVVLNNIRKMQPHTFIH 662
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++a
  Zmw_sc00758.1.g00210.1.am.mk 663 AIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSDQRMLIEQNIFGRSALNVIACEGTDRVERPETYKQWQVRNQRA 743
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   G+k++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zmw_sc00758.1.g00210.1.am.mk 744 GLKQLPLNRETVEIVRGKVKDCYHKDFVIDIDHHWLLQGWKGRILFAISTW 794
                                   ***********************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.987397775IPR005202Transcription factor GRAS
PfamPF035142.8E-106423794IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
MQWKAGEMSP GPKPPLVGNG NAVECWRKVD TDKIKRCLEV ERDLPNLQGP GYDIDVSTTI  60
HGASIGHEIV IQTEYVYQRT VSSSLFVWSR TQVDGVERLI LFRFNLPRIS AVSKSPFPPP  120
PSRNLPLPVS TPCPPAAYKS TPSPLSLSSS RARPRPATHA AAMGSSYDLY QSPGADDPSL  180
YLYLSDLVPD SPSAYLDLPP TPHHEQQQPP PVPTAATDDG AAAGSPEDLV LPYISRMLME  240
DDIEDKFFYD YPDNPSLLQA QQPFLEILSN SDDTTTTTTT TSSSGGDHHG DPSPTSSSSD  300
GASAPAPSPA PPVAPAVTLS VKEERVDAAP GNGVGRGRKN PYDHDELEVE GGRSSKQSAV  360
QGEDDATRDM LDRVMMPSHE ACVLQMQQLR IAMQEEAAKN EAGGKAGNGK AKGRRGGRDV  420
VDLRTLLIHC AQAVATDDRR SATELLKQIK QHASPQGDAT QRLAHCFAEG LQARLAGTGS  480
MVYQSLMAKR TSAVALLQAY QLYMAAICFK KVAFIFSNYT IFNASLGKKK IHIVDYGIHY  540
GFQWPCFLKQ ISGREGGPPE VTITGIDLPQ PGFRPTERIE ETGRRLSNYA REFGVPFKYH  600
AIAASKMESV RKEDLNIDPD EVLIVNCMYQ FKNLMDESVV IESPRDVVLN NIRKMQPHTF  660
IHAIVNGSFS APFFVTRFRE ALFYYSALFD VLDTTTPRDS DQRMLIEQNI FGRSALNVIA  720
CEGTDRVERP ETYKQWQVRN QRAGLKQLPL NRETVEIVRG KVKDCYHKDF VIDIDHHWLL  780
QGWKGRILFA ISTWVANDAG CPYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-444277948374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-163SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297