PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00754.1.g00350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 389aa    MW: 42347.3 Da    PI: 6.4012
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00754.1.g00350.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.44.8e-52151421128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeel+ +yL++++++ ++++  +i++vdiyk++PwdLp k+  ++ ewyfFs+rd+ky++g r+nra+ sg
  Zmw_sc00754.1.g00350.1.sm.mk  15 LPPGFRFHPTDEELILHYLRNRAASVPCPV-PIIADVDIYKFDPWDLPCKAVYGDGEWYFFSPRDRKYPNGIRPNRAAGSG 94 
                                   79****************************.88***************66666789************************* PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg+dk+++++ +ge vg+kk Lvfykgr pkg+kt+W+mheyrl
  Zmw_sc00754.1.g00350.1.sm.mk  95 YWKATGTDKPIHDSaTGESVGVKKALVFYKGRPPKGTKTSWIMHEYRL 142
                                   ************9988999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-645178IPR003441NAC domain
PROSITE profilePS5100560.37715178IPR003441NAC domain
PfamPF023654.6E-2716142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEETMVSTQA AAPLLPPGFR FHPTDEELIL HYLRNRAASV PCPVPIIADV DIYKFDPWDL  60
PCKAVYGDGE WYFFSPRDRK YPNGIRPNRA AGSGYWKATG TDKPIHDSAT GESVGVKKAL  120
VFYKGRPPKG TKTSWIMHEY RLAAGYPLAA AAAYRPPVKF RNASMRLDDW VLCRIYRKSD  180
QASPTAPPIA DYDSHLLDHD ELSSGGLYVD DICSSFYGPT SGGGTTPSFG TMNATTHHHQ  240
QQDTPARHPT IASFPEFFDD YSLAHMFDSA VPSDGDQQHA AFAMHPSLNQ LLAVGDSAQY  300
SSESSDLIYS SDYPGAAGAL GGVAKRKVMM SQQLDDDCVV DAGNPPAKKL HLSCFDAPQT  360
ATGGVLSATS SHSRVLSGLT NHNNILPQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-7011836170NO APICAL MERISTEM PROTEIN
1ut4_B2e-7011836170NO APICAL MERISTEM PROTEIN
1ut7_A2e-7011836170NO APICAL MERISTEM PROTEIN
1ut7_B2e-7011836170NO APICAL MERISTEM PROTEIN
3swm_A2e-7011839173NAC domain-containing protein 19
3swm_B2e-7011839173NAC domain-containing protein 19
3swm_C2e-7011839173NAC domain-containing protein 19
3swm_D2e-7011839173NAC domain-containing protein 19
3swp_A2e-7011839173NAC domain-containing protein 19
3swp_B2e-7011839173NAC domain-containing protein 19
3swp_C2e-7011839173NAC domain-containing protein 19
3swp_D2e-7011839173NAC domain-containing protein 19
4dul_A2e-7011836170NAC domain-containing protein 19
4dul_B2e-7011836170NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025800259.11e-144NAC domain-containing protein 48-like
TrEMBLA0A1E5V1K61e-147A0A1E5V1K6_9POAL; NAC transcription factor 29
STRINGTraes_2BS_C116E5668.11e-144(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123