PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00743.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 477aa    MW: 52222.7 Da    PI: 9.1688
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00743.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.5e-551742991128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k+ePw+Lp+k++ +ekewyfFs rd+ky+tg r+nrat+sg
  Zmw_sc00743.1.g00090.1.am.mk 174 LPPGFRFHPTDEELVTYYLTHKVSDFAFTT-RAIADVDLNKCEPWELPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 253
                                   79*************************999.89***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkg kt+Wvmheyrl
  Zmw_sc00743.1.g00090.1.am.mk 254 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGGKTSWVMHEYRL 299
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-63168320IPR003441NAC domain
PROSITE profilePS5100559.459174320IPR003441NAC domain
PfamPF023651.4E-28175299IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MLPSSGRSEL SIGSPLTGFW SNNEDSATRG FSWLELAGNP SLHRGVNLKR RIDASSSLLS  60
TSPSPSPVIL AVVFGPRLKT KRIGQKEEER AARAGLVVYY CVALTSLHAR THAVRALVQL  120
LAFFRFRVFL CHYICAIAGG TVAATPAVAA DCALTHSLHA GRALRPRVVM EEGLPPGFRF  180
HPTDEELVTY YLTHKVSDFA FTTRAIADVD LNKCEPWELP SKASMGEKEW YFFSMRDRKY  240
PTGIRTNRAT DSGYWKTTGK DKEIFHCGML VGMKKTLVFY RGRAPKGGKT SWVMHEYRLQ  300
NKFPYKPNKE EWVVCRVFKK CQIIKVRPPT DSPTMDSPYH DGNASLGELD VSSILSNLTP  360
ASVHTSSSAP GEGFGHRVDM NAYMSWMAAA NQGAAAAAMI PWAMAPGLLG NVFAAPNQPY  420
AGCSPSQPRE IGGVVANVGG GQAMFVSSVA KVDMECDQQH QPPPQQLGID DSTWGAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5417432017165NO APICAL MERISTEM PROTEIN
1ut4_B2e-5417432017165NO APICAL MERISTEM PROTEIN
1ut7_A2e-5417432017165NO APICAL MERISTEM PROTEIN
1ut7_B2e-5417432017165NO APICAL MERISTEM PROTEIN
3swm_A2e-5417432020168NAC domain-containing protein 19
3swm_B2e-5417432020168NAC domain-containing protein 19
3swm_C2e-5417432020168NAC domain-containing protein 19
3swm_D2e-5417432020168NAC domain-containing protein 19
3swp_A2e-5417432020168NAC domain-containing protein 19
3swp_B2e-5417432020168NAC domain-containing protein 19
3swp_C2e-5417432020168NAC domain-containing protein 19
3swp_D2e-5417432020168NAC domain-containing protein 19
4dul_A2e-5417432017165NAC domain-containing protein 19
4dul_B2e-5417432017165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795943.11e-164protein CUP-SHAPED COTYLEDON 1-like
TrEMBLA0A1E5WJW11e-175A0A1E5WJW1_9POAL; Protein CUP-SHAPED COTYLEDON 2
STRINGPavir.Ib03976.1.p1e-167(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450