PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00731.1.g00300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 209aa    MW: 22438.9 Da    PI: 8.5821
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00731.1.g00300.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.55.9e-4136112278
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     CqvegC  dl+ akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Zmw_sc00731.1.g00300.1.sm.mkhc  36 CQVEGCGLDLTGAKEYHRKHRVCEAHTKCPRVVVAGHERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 112
                                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.2E-332997IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.2433110IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3934115IPR004333Transcription factor, SBP-box
PfamPF031103.7E-3136109IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MPASGSSGEA PARRGGRERE GKRAKGEDGG AGEVKCQVEG CGLDLTGAKE YHRKHRVCEA  60
HTKCPRVVVA GHERRFCQQC SRFHALSEFD QKKRSCRRRL SDHNARRRKP QPDAFAFASA  120
RLPSSLFGPD TSITASKFDG APDLQHALSL LSAGSCGFPD PVQQASCLIQ FSGTSENSGD  180
LHSSHGGSSA LVSCADEQHT APQSQLSYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2726109184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
191108KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688371.11e-82PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ6H5092e-53SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLC4JBI62e-74C4JBI6_MAIZE; Squamosa promoter-binding-like protein 2
STRINGGRMZM2G163813_P023e-75(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]