PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00731.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 413aa    MW: 44069.2 Da    PI: 7.0758
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00731.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.97e-39182258177
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka++v+  g+++rfCqqCsrfh l efDe+krsCr+rL +hn+rrrk++
  Zmw_sc00731.1.g00070.1.sm.mk 182 RCQAEGCKADLSAAKHYHRRHKVCEYHAKAAAVADGGKQKRFCQQCSRFHVLAEFDESKRSCRKRLTEHNRRRRKSA 258
                                   6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-33176244IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.539180257IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-36181258IPR004333Transcription factor, SBP-box
PfamPF031102.4E-29183256IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MSPATTDADF AFAPMQPNLG FDVAGNSHQD QHNLYDNYVD FAAGFPFQQD SSMSLLPPQT  60
SLPLLAPPPC LAMTAMPSLS PNHQMPLLGV QNAEICHPFN GSAGSPFLMK REDGPLVDAG  120
GGGGGRLGLN LGRRTYFSPA DVLAVDHLLM TRSSRFGVGM GMAGLLGLGL GAAHHHQPPP  180
PRCQAEGCKA DLSAAKHYHR RHKVCEYHAK AAAVADGGKQ KRFCQQCSRF HVLAEFDESK  240
RSCRKRLTEH NRRRRKSASA QGGEDSYPLP KKADTTSITT SYNSDQKSAS TVAAKSTAIS  300
PNDSGVSCLD MADNNGHQTS SAAAAAAPTA LSLAAPPEKD SGGLDAILMM HGSRVHRDDD  360
EDQRFIPSLL LQAQQQQQHH NDGGHMLSCS SSMPDQHQNG GGGCNGFFEV DFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-271832561184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451645.21e-129squamosa promoter-binding-like protein 5
SwissprotQ0E3F81e-57SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A1Z5RL611e-128A0A1Z5RL61_SORBI; Uncharacterized protein
STRINGSb04g005180.11e-129(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593