PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00711.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 383aa    MW: 40348.2 Da    PI: 6.1833
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00711.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.1e-18264298135
                            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                     C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Zmw_sc00711.1.g00180.1.sm.mkhc 264 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 298
                                     99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.1E-701343IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.571258294IPR000679Zinc finger, GATA-type
SMARTSM004013.6E-18258308IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.2E-15259295IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.14E-15260321No hitNo description
CDDcd002021.55E-14263310No hitNo description
PROSITE patternPS003440264289IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15264298IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEAAEATEYG HYGGAGRERK VAGCGGDLFA VDDLLVLPYD DEEECDGEAP VVDAAGGGGG  60
TVKVKEEGGF GNLSADSSTV TTALDSCSNS FSGLANGDFS GELCEPYDQL VELEWLSNYM  120
GEGEDTFATE DLQKLQLING LSAGGFSSSA AKVSPAPVAS STQLAGRMFL PEAPVPAKAR  180
TKRYRAAPGN WSSRHLVLPP TPASPPSPAS MAISPAESGI SVQAFQAAKK PSKKKDAPQA  240
QPPSSAPAQS SGSGLAASAE GRRCLHCETD KTPQWRTGPM GPKTLCNACG VRYKSGRLVP  300
EYRPAASPTF VMSKHSNSHR KVLELRRQKE IQHGHQPHVM AGNGAGGLMH MQNPLLFDGQ  360
PIMAGDDFLV PQHLGPDYRR QLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969927.11e-159PREDICTED: GATA transcription factor 12
TrEMBLK3XIL31e-159K3XIL3_SETIT; Uncharacterized protein
STRINGSi001735m1e-158(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178