PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00693.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 424aa    MW: 45786.4 Da    PI: 7.7157
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00693.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26064.52.6e-2053102150
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalp 50 
                                   +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll+   
  Zmw_sc00693.1.g00100.1.am.mk  53 PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQVRT 102
                                   7********************************************98654 PP

2DUF26050.18e-1613218646100
                        DUF260  46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                    ++lpe+ r da+ss+vyeAear+rdPvyG++g++ +lq+q ++lk++la++++ 
  Zmw_sc00693.1.g00100.1.am.mk 132 SQDLPESSRADAVSSMVYEAEARLRDPVYGCAGTVCRLQKQANELKVQLARAQAD 186
                                   6899**********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.73152187IPR004883Lateral organ boundaries, LOB
PfamPF031957.1E-2053106IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-14132184IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MDYSNASTGT TAEHSYRSES PPSLVSTSCS PPPPPLPAAQ LIGNVAPTVV MSPCAACKIL  60
RRRCADGCVL APYFPPTEPA KFTTAHRVFG ASNIIKLLQV RTVQSQASRA ARGHHNTYTH  120
GNVLTGAFVP ASQDLPESSR ADAVSSMVYE AEARLRDPVY GCAGTVCRLQ KQANELKVQL  180
ARAQADLLNA QAQHANLLAL VCVEVANRRD SQRQQQQPSP PLMEYGGSRS EVGDAGYQMF  240
YDDSDLLDSA TWPLEPDRAG CQAHRCVHHT GHAHSAKKTE DELTRRDARA SDARCHGSSS  300
SAKEGAASQR RKSIVTISLV RLLFDHGYLE IAYGSVSDSY EVADGVSLES RRMNPKHPWI  360
HMPTVQGEGV WRPDELLPIF WKPGTVTAMA SSVGRGVAST EQTEGSLRCA ARTVVPGDAT  420
LKSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-325218810112LOB family transfactor Ramosa2.1
5ly0_B1e-325218810112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987050.25e-95LOB domain-containing protein 1
TrEMBLA0A368SSE31e-93A0A368SSE3_SETIT; Uncharacterized protein
TrEMBLK4AEH38e-94K4AEH3_SETIT; Uncharacterized protein
STRINGPavir.Ib01336.1.p1e-100(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790