PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00617.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 192aa    MW: 21259.2 Da    PI: 9.1272
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00617.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM32.62.3e-101560147
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdL 47
                                  lppG++F+Pt+ ++vv+yL+  + +++l+   +i++ di++ +PwdL
  Zmw_sc00617.1.g00070.1.sm.mk 15 LPPGYKFNPTNRDIVVRYLHCCAMNQPLPS-GIIADKDILDQNPWDL 60
                                  79**************************99.89*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-151285IPR003441NAC domain
PROSITE profilePS510059.92815143IPR003441NAC domain
SuperFamilySSF1019411.7E-15131143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MAASVPLATE ASIPLPPGYK FNPTNRDIVV RYLHCCAMNQ PLPSGIIADK DILDQNPWDL  60
VPGKRTDWVM QEYHLAGGGL IPYRVVRSSM KHNLGEVSRT LKDVSKEDDD QGNTLHGTAP  120
NIENTNIILK PDSSWVVCRI YKKRTRTASL IIRNTSSARA EKIRSFDFLG QGNQNKGTSS  180
SSMLSYVEGN SI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4703222