PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00613.1.g00290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 621aa    MW: 65185.8 Da    PI: 8.1087
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00613.1.g00290.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.21.4e-962546212374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                   ++lL e+A a+++g++e a + La l+  a+p+gd  qRl+a+++ AL++r+a       ++ p+++ +e    e+ +  +
  Zmw_sc00613.1.g00290.1.am.mk 254 RQLLSEAAVAIADGNFETAATQLAALKRAANPRGDVEQRLIAMMVAALSSRIAP-----TASAPAQHLAELCGLEQRNGSQ 329
                                   789**************************************************9.....4455666666566778888889 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeele 159
                                    +++ sP+++++  +aN aI+eav  ++++H++Dfd+s + Q +aL+q La+R+ +  sl++T+v +p+s     ++ +l 
  Zmw_sc00613.1.g00290.1.am.mk 330 HLHDRSPCFRLALYAANVAIVEAVGDHRAIHVVDFDVSAP-QHAALIQYLADRRVPGTSLKVTAVTDPSSPftqsQTATLP 409
                                   9************************************987.99************************998889989999** PP

                          GRAS 160 etgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                                   ++gerL+k+A++ g++ +f++ v+ r ++l+  +L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l ++vv+
  Zmw_sc00613.1.g00290.1.am.mk 410 AVGERLKKLADRAGIEYHFKM-VSCRAAELDAAKLGLEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGAQVVT 489
                                   ********************9.7999******************************************************* PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   +veqe+++n++++++rf++a+ yy a++dsle++l+r+s er++ E + l++++ n+v  ega+r er+e ++kWr+r+++
  Zmw_sc00613.1.g00290.1.am.mk 490 LVEQELNTNTAPLAARFTDACAYYGAILDSLEVTLGRDSAERAMAESA-LAKKAANAVGREGADRLERCEVFGKWRARFGM 569
                                   ***********************************************9.9******************************* PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   aGF+pv+ls ++a+q+ + +   + +g++++ e+g l lgW++r ++++SaWr
  Zmw_sc00613.1.g00290.1.am.mk 570 AGFRPVALSPSIADQVVARVGPAP-QGFTMKPENGVLRLGWMGRVVTVASAWR 621
                                   ***********************9.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.149227602IPR005202Transcription factor GRAS
PfamPF035144.9E-94254621IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MPWGPAITTP DKHQRTHHPP LCGLGHAVSG SAGESVSDPK RRVPFRNRSL GELERWQHQQ  60
VAAQQALYLR AVRQRTAAAA LLGGAPSHQP MVLPGSSYGG ALASPSSTLS SLTTASGAAV  120
PLMQPQMHRQ VPLMASSAQQ TQALGVSRAP PPPPASSSDM FLLQELEKQL LGDDDEPVAA  180
MSGTGSAVTN SEWEETIQQL NSITAGASPV VPAPVTPNNN AAGMTRSPSN SSSSTASSSA  240
SCSPPTPGAA AATRQLLSEA AVAIADGNFE TAATQLAALK RAANPRGDVE QRLIAMMVAA  300
LSSRIAPTAS APAQHLAELC GLEQRNGSQH LHDRSPCFRL ALYAANVAIV EAVGDHRAIH  360
VVDFDVSAPQ HAALIQYLAD RRVPGTSLKV TAVTDPSSPF TQSQTATLPA VGERLKKLAD  420
RAGIEYHFKM VSCRAAELDA AKLGLEPGEA LAVNLAFALS HVPDESVSPA NPRDELLRRV  480
RALGAQVVTL VEQELNTNTA PLAARFTDAC AYYGAILDSL EVTLGRDSAE RAMAESALAK  540
KAANAVGREG ADRLERCEVF GKWRARFGMA GFRPVALSPS IADQVVARVG PAPQGFTMKP  600
ENGVLRLGWM GRVVTVASAW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4027262122375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK7UKW80.0K7UKW8_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474