PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00591.1.g00300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 804aa    MW: 86207.7 Da    PI: 9.4276
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00591.1.g00300.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.69.5e-31384436558
                   ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   rY+eClkNhA+ +GghavDGCgEfm++ geegt +al+CaAC+CHRnFHR+e+ 
  Zmw_sc00591.1.g00300.1.am.mk 384 RYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTLDALRCAACNCHRNFHRKESP 436
                                   8*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-27362437IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.6E-29384434IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-28384435IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.752385434IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.25E-12522584IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-23524584IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-19534584IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
MDHGLASPRC YKTTCWVGTA VRMDSDEHAC HQPGPQSTPT KIANGKQRTP SSRRRPCMDH  60
RHHRSRRMET SDPVSRSRGK DRRITGLAAC GHPRRLPLDP ALTAGLIAPA TVEIRPPPKT  120
SPAGAQACTR VSAVDETHLV ASHAGRMEGA QLACSGEVAC SLPRPHFRCL LFRSGVGDRR  180
EANTVNWTKR TAPVEALPAK IDGAVYSSVT SCVGAKPLEK SSGERDSHAA KKAMSATQRN  240
AISSPVEVSG GREIGQERTK RGLGDERAAP RQNWQPDGVH TLSYLLISLL TLLSRSLSFA  300
CHNSRSQTQE APASCLLASQ AAMDFDDHDD GDEEMAPLPP VLSSSYETPP QSAAFGGGVA  360
PAAKPPSEPG SRANKDPGGG GSGRYRECLK NHAVGIGGHA VDGCGEFMAA GEEGTLDALR  420
CAACNCHRNF HRKESPTAEG SPISPAAIVA YGAMPHQQFS PYYRTPAGYF HHTPHHMAAG  480
HQQRPLALPS TSHSGRDDVD DLSGMAGPMS ALGPLSGMSL GAGPSGSGGS GSGKKRFRTK  540
FTQEQKDRML AFSERLGWRI QKHDEAAVQQ FCDEVGVKRH VLKVILTPPP HSMHPRASAH  600
APPQSSCWIV SMAAIPLRAK LLSLAAEGRR RRRCTGRERQ RCQLSMWKSG TERMEKQENT  660
LSSQLPLGPL PRAIARCHGV LAASAALLIF HLAPLCFEYA RYADAWLDDD GGLFMSGHRV  720
WVGSAEQRGE PSAGAIRGCG RASCLCPQRS AGRGEGLPDC PLGSLHAHLA SRKHAVAVVH  780
VCLLTAGRTR FRDVVLGFFL AKLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-205355841867ZF-HD homeobox family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269