PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00582.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 395aa    MW: 41493.9 Da    PI: 7.8581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00582.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.7e-4343141199
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+
  Zmw_sc00582.1.g00280.1.am.mk  43 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKILNELHPCQREDAVNSLAYEADMRLRDPVYGCVGVIS 123
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallke 99 
                                    lq++l+q ++el +++ 
  Zmw_sc00582.1.g00280.1.am.mk 124 VLQHRLRQIQQELTRAHY 141
                                   *************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.84242143IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4343139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGSSSASSVP VSTTGSVITG TAASSPMVGS ISVGAAGTGT GSPCAACKFL RRKCQPDCVF  60
APYFPPDNPQ KFVHVHRVFG ASNVTKILNE LHPCQREDAV NSLAYEADMR LRDPVYGCVG  120
VISVLQHRLR QIQQELTRAH YELSKYQVAA EAAAAASATV GSNAGPAPMP DFIGNPVPNC  180
TQNFINMGGH SMAATIDGAG FMQHDQFATV QMLGRSYDAD PTTTARVGLS VGGGGDGGYG  240
FGYSSSMGGE HSGLGSISGP FLSPTPPAGT SAPQPRSSGM FSHLRQRLED GDASCTLRMH  300
LTCGEQHRHR CRCDATLAID RGVISMRARV CKCPAMTDAL SALSEERRCA GDIQCNDASS  360
TVAPACTPPS PARLRSMREW FRSLTLSLHA CVVSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-52391467114LOB family transfactor Ramosa2.1
5ly0_B2e-52391467114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808846.11e-107LOB domain-containing protein 6-like
SwissprotA2WXT01e-100LBD6_ORYSI; LOB domain-containing protein 6
SwissprotQ8LQH41e-100LBD6_ORYSJ; LOB domain-containing protein 6
TrEMBLA0A2S3HCF21e-106A0A2S3HCF2_9POAL; Uncharacterized protein
STRINGSi024114m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]