PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00549.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 637aa    MW: 68126.8 Da    PI: 9.3415
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00549.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer987e-31419471558
                   ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   rY+eClkNhA+ +GghavDGCgEfm++ geegt +al+CaAC+CHRnFHR+e+ 
  Zmw_sc00549.1.g00200.1.am.mk 419 RYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTLDALRCAACNCHRNFHRKESP 471
                                   8*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-26395472IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.7E-29419469IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.1E-28419470IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.752420469IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.24E-19562635IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-31564636IPR009057Homeodomain-like
TIGRFAMsTIGR015658.5E-25574630IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MDSDEHACHQ PGPQSTPTKI ANGKQRAPSS RRRPCMDHRH HRSRRMETSD PVSRSREKDR  60
RITGLAACGH PRRLPLDPAL TAGLIAPATV EIRPPPKTRL ARVFLLWTKH TSSQATCRPV  120
VKQQAARITH AGVGIEAYPP SEPRESVTWA LPGWDKQEVP YSLGGGLFGT NQAGQMEGAQ  180
PACRGEVACS LPCPHFRCLL FRSAVGDRRE ANTVNWTKRT APLEALPAKI DGVVYSSVTS  240
CVGAKPLEKS SGERDSHAAK KAMSATQRNA ISSPVQVSGG REIGQERTER GLRGPSCSKR  300
AAPLQNWQPD GVHTLSYLLI SLLTLLSRSL SFACHNSRSQ TQEAPASCLL ASEAAMDFDD  360
HDDGDEEMAP LPPVLSSSYE TPPQSAAFGG GVAPAAKPPS EPGSRANKAP GGGGGGSGRY  420
RECLKNHAVG IGGHAVDGCG EFMAAGEEGT LDALRCAACN CHRNFHRKES PTAEGSPISP  480
AAIVAYGAMP HQQFSPYYRT PAGYFHHTPH HMAAAAAAAG HHSRPLALPS TSHSGRDDVD  540
DLSGMAGPMS ALGPLSGMSL GAGPSGSGGS GSGKKRFRTK FTQEQKDRML VFSERLGWRI  600
QKHDEAAVQQ FCDEVGVKRH VLKVWMHNNK HTLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-265756321875ZF-HD homeobox family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269