PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00535.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 390aa    MW: 43338.8 Da    PI: 7.9379
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00535.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-0978136563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l +++
  Zmw_sc00535.1.g00210.1.am.mk  78 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQN 136
                                   999*******************************************9998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-1674138IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.71476139IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-1078128No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-1078135No hitNo description
PfamPF001703.6E-978136IPR004827Basic-leucine zipper domain
CDDcd147037.21E-2279128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MNGAANGHGM VHHHLHHHAQ ASAPLSTAFP LPAQHHQQQQ GAGGKFSLEF GGGEFTPAEM  60
KRIMADEKLA EMALADPKRV KRVLANRQSA ARSKERRMRY IAELEQKVQI LQTEATTLSA  120
QLTLLQRDSS GLATQNNELK FRLQAMEQQA QLRDALNEAL SAEVQRLKVR DASSSSNLPQ  180
QMQLRYQSQM HELHKQQQGE QIPFYQLEQR EQNGVARNHD ANVRSSEPQR PACPAVLPTE  240
QGRLRGMAIA HGRPHPRHVR PRPLPYAGLG TRPGPLRCIH AWDSSIDIEH DAHSYGELAN  300
GLGHIPAPRR FRGNRIKICS MPPVKMTSTR SGLLGHHSVL LSAMGFDDEL EGEEVESVAS  360
KGLTEDCYGD NSCSETTNED DMRLLISTCC
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576