PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00514.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 435aa    MW: 48637.4 Da    PI: 11.7821
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00514.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.8e-502653891128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtd elv++yL++k++g +l +  vi+evd+yk++Pw+Lp+k+ ++ekewyfFs+rd+ky++g+r+nra+ +g
  Zmw_sc00514.1.g00170.1.am.mk 265 LPPGFRFHPTDGELVNYYLCRKCAGLPLAA-PVIAEVDLYKFDPWQLPEKAMGGEKEWYFFSPRDRKYPNGSRPNRAAGTG 344
                                   79*************************999.89***************8888999************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg dk+v s   + v +kk Lvfy g+ pkg+kt+W+mheyrl
  Zmw_sc00514.1.g00170.1.am.mk 345 YWKATGADKPVGS--PRPVAIKKALVFYAGKPPKGVKTNWIMHEYRL 389
                                   ***********99..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-56261394IPR003441NAC domain
PROSITE profilePS5100553.589265412IPR003441NAC domain
PfamPF023653.1E-25266389IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
LRKLRCLSVV RPVPSRGRVS PRRGRSLGDR EPCDAAARHV TSRSRRVHAS DDRDQTKPSK  60
ARDPGHCAAR ERSARLSARG GSRRPRLLPP RSSGLEINPP ASARPRQPSP ATKLLTQAMT  120
KSRPALDPHR RIRPPTRRAR LRDARRASSR ALGQTSLERQ LARASHRPSV DTCPAAVYIV  180
APGTASWCST HAYSRSPERP DTLTQRERER ERESSLPSSS GSVLLLRRRP PSPRDPTRSS  240
VRPATHPPTS LDRTLEMDCG DALQLPPGFR FHPTDGELVN YYLCRKCAGL PLAAPVIAEV  300
DLYKFDPWQL PEKAMGGEKE WYFFSPRDRK YPNGSRPNRA AGTGYWKATG ADKPVGSPRP  360
VAIKKALVFY AGKPPKGVKT NWIMHEYRLA DVDRSAAARK RTNNALRHAP YRAVPFDPAC  420
GWLRRLSQQT SLTFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-672563896140Stress-induced transcription factor NAC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6765422