PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00505.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 841aa    MW: 91251.2 Da    PI: 11.4477
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00505.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1444.8e-14276317546
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                                     +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++Nk+L 
  Zmw_sc00505.1.g00070.1.am.mkhc 276 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNKELE 317
                                     79************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.9E-12272335IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.047274319IPR004827Basic-leucine zipper domain
CDDcd147076.25E-23276327No hitNo description
SuperFamilySSF579595.34E-11276321No hitNo description
PfamPF001701.3E-11276318IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-14276319No hitNo description
PROSITE patternPS000360279294IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MEFKSGRSSS SSSQRRPSSV ADGAPVANQG SVYSLTFDEL QSTLGGAAAG GSGVGKDFGS  60
MNMDELLRNI WTAEETHAMA STSTAGPGAP PAPLQRQSSS LTLPRTFSTK TVDEVWRNLV  120
HDEPQEGAVA GAGQQTQRQS TLGEMTLVEF LVKAGVVREN PAPVLPPMPP PSRPVPVAPK  180
SATAFGNFPG ADDAAAATLG FAPVGMGNLT LGNGLMPRAT GMGAGALAAQ TAVSQLDSGV  240
KGNGDLSSPT ETLPYSFGGM ISGRWNGGGV EKVVERRQRR MIKNRESAAR SRARKQAYTM  300
ELEAEVQKLK EQNKELERKQ VVFLKVLVLP MECVTSPHGP RETEITALVW DFERLGFGLA  360
DVMLKRAPEK LAHTSCALRT IHNARNRTHG RGPTTRRPRR GTSLTHVVPP TLHSMTSAVP  420
DTGPGEPAVR HHCLGARTGA RRHRHGFTRE TYDAHVSYCV RPLPHHVRPC VVIFSVRFTR  480
NSSSSPSPGK TIEKWRFEAS STSGNGSCYR ALFRGQQRNQ VDPPQKAGTK PRCYRIKSHL  540
PQLRLSCAVL SRSSDQPASM RSHDAVNHLG GGAGEYLHPA RRSKTTPNEA QAFWRGRVRR  600
MISKPHAAPR LRNVALAPRS RRCPTRGEHA VRANRERASF TAPHSSQPSD AASTRAGSQP  660
RAPVRPATGT TRSTVYYVRQ VRFHAILCPP YHEHITVVRW GNNAATGETA DYFDQGFRST  720
GLVFNSTSAE NPMFVTTVGE GRFRRRQPQG DAAGFTCCHS PPAGGNPAGA LISHHHRHHQ  780
SWRRITRRSQ AKRERASLVH GPPAARKVAG ERKKRARPCV RAWANGCGVR GCPSVPVVRC  840
L
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147