PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00467.1.g00460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 948aa    MW: 103319 Da    PI: 7.3313
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00467.1.g00460.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP66.65.4e-21179225147
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47 
                                     +Cqv++C+adl++ak+yhrrhkvCe+hsk++++lv++++qrfCqqCs
  Zmw_sc00467.1.g00460.1.sm.mkhc 179 MCQVDDCRADLTSAKDYHRRHKVCETHSKTTKALVANQMQRFCQQCS 225
                                     6*********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.6E-23173225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.204177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-20178226IPR004333Transcription factor, SBP-box
PfamPF031103.6E-15180226IPR004333Transcription factor, SBP-box
CDDcd002042.29E-4736837No hitNo description
Gene3DG3DSA:1.25.40.207.2E-4739837IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    Send to blast
MQREVGPQVA PPLFLHQIQQ LPPHAAAAKK RGHPWPAVPP AKPAVVADAG AGGGNWNPRL  60
WDWDSRSLTA RPSPDALRLG SGAGQSQQQP PPPAARAAEA SRQGSGALNF QLGLREDGAT  120
AMDTTGPATV ASSPSPPRST AAGQEPVVRP SKRVRSGSPG SAGGSGGGGA ANGGGSYPMC  180
QVDDCRADLT SAKDYHRRHK VCETHSKTTK ALVANQMQRF CQQCSSNNAG KVPSIPPIPD  240
KQNLVEIISK IKSLNNTNST TESPPSEGVA LNASNGQQQD SAQKMTNGTE KPTVPSTMDL  300
LTVLSTALAT STPEQSQGSS DSSGNNKNKV DEEVRHPQAA DYGEGTAVVE VSTSRAWCAP  360
PLEVFKDSER LTENGSPPNP GYQSCYASTS CSDHSPSSSN SDEQDRTGRI IFKLFGKEPS  420
TIPGNLRSEI INWLKHSPTE MEGYIRPGCL VLSLYLSMPP IAWDDLEENL LQRVNMLVQG  480
SDVDFWRKGR FLVRTDTQLV AYKDGMTRLS KSWRTWNTPE LTFVSPIAVV GGKKASLVLK  540
GRNLTVPGTQ IHCTNMGKYI SKEVLCSAYP GTIYDDSGVE TFDLPGEPNL ILGRCFIEVE  600
NRFRGNSFPV IVANPSVCQE LRNLEVELED SQLHDVCLDD QVHNRRQSKA RDQALHFLNE  660
LGWLFHRDAA CTPSTKSDVC DSDLIQFSIF RFKHLLLFSS ERDWCSLTRT LLDILAKRSL  720
VSEELSQETL GMLSEIHLLN RAVKRKSNRM VHLLVQYVVI CPDNSKLYPF VPNLPGPGGL  780
TPLHLAASIE NAEDIVDALT DDPQQIGLSC WQSVLDNDGQ SPETYAKLRN HNSYNELVAQ  840
KLVDRKNNQV TIMVSKGEIL VDQLGNDGDN KKSGTQALQI TSCSQCAILE SGVLRQPLRS  900
RGLLARPYIH SMLAIAAVCV CVCVFMRALL RFNSGRSFKW ERLDFGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A9e-20175225151squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021320166.10.0squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLA0A1B6PIZ00.0A0A1B6PIZ0_SORBI; Uncharacterized protein
STRINGPavir.Fa00457.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853