PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00467.1.g00220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 767aa    MW: 82958.3 Da    PI: 10.1895
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00467.1.g00220.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.6e-52301571128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv + ++     i+evdi+++ePw+Lp +++ +e+ewyfFs rd+ky+tg r+nrat +g
  Zmw_sc00467.1.g00220.1.am.mk  30 LPPGFRFHPTDEELVTFYLAAKVFNGTCCG-VDIAEVDINRCEPWELPGAARMGEREWYFFSLRDRKYPTGLRTNRATGAG 109
                                   79*************************777.34***************8888899************************** PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ev+++ +g+l+g+kktLvfykgrap+gekt+Wv+heyrl
  Zmw_sc00467.1.g00220.1.am.mk 110 YWKATGKDREVICTtTGALIGMKKTLVFYKGRAPRGEKTKWVLHEYRL 157
                                   ***********99878899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6119186IPR003441NAC domain
PROSITE profilePS5100558.4530186IPR003441NAC domain
PfamPF023651.3E-2631157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MMMHQPQAMG DALWDILGEE MAAAAGEHCL PPGFRFHPTD EELVTFYLAA KVFNGTCCGV  60
DIAEVDINRC EPWELPGAAR MGEREWYFFS LRDRKYPTGL RTNRATGAGY WKATGKDREV  120
ICTTTGALIG MKKTLVFYKG RAPRGEKTKW VLHEYRLDGD FAAGRRFCKV TDLSAEEWVI  180
CRIFHKAVDQ YSKMVMSMSP YYHATDPSSF CFQQEPPHAA LPLPNPSICS GLAHALPFHH  240
SLENHHQGKS NVDTNGLPAA SSLDQPNGSG GVNMCDSSAM PMLPAFPSFA SVVVTGKAAP  300
HQQEAGVNAG PPEPPTLLDG YIAHSGVLYE MSPPAAPRGA SEMDGDHECL PMQGVGLAGA  360
GEEQVATGRP RRDPCVRAPR DQSLVNRRRR RIGSGRRPAP IDLVVPKGWP ATRFAAKVKP  420
LTAGRQQQIA VNLKSQIFVK TEEDRQSLYV TTLPLDWVGK RPTKPLAQHQ IEYDAASHLN  480
SPFLSNSCLP GHWAAVRRET GRMWAARGRP QLLTNNIPRC CFSGFRWEFR RRSASEPGEP  540
PSAFSDELGR GASHTQLFSR QPGPMKQSGP CSTTPIGPGP QASLGTRAEQ KSSRHRAAAG  600
PRLAVDVGRP RACSGARARP EEQGLRSVSV LPRASRRRGN AGVITAGEKT LTPHCGSSRS  660
RAPPAPRING PGAAGDGPRA GDRTRVCPPC VVVIRNGTGR MHGIGMAGTS AGGTRPCRSA  720
VNSAGTARAS MHRAAARPHA DTHVRMLHGK LRWLGAHRGT RAVALSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-463018620168NAC domain-containing protein 19
3swm_B2e-463018620168NAC domain-containing protein 19
3swm_C2e-463018620168NAC domain-containing protein 19
3swm_D2e-463018620168NAC domain-containing protein 19
3swp_A2e-463018620168NAC domain-containing protein 19
3swp_B2e-463018620168NAC domain-containing protein 19
3swp_C2e-463018620168NAC domain-containing protein 19
3swp_D2e-463018620168NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112373341