PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00443.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 845aa    MW: 91941.2 Da    PI: 11.2047
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00443.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.6e-4147123278
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   C v+gC+adls+ ++yhrrhkvCe+hsk+p+v+v+g+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q+
  Zmw_sc00443.1.g00050.1.am.mk  47 CAVDGCKADLSKGRDYHRRHKVCEAHSKTPTVVVAGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQP 123
                                   **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3539108IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18844121IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-3845126IPR004333Transcription factor, SBP-box
PfamPF031102.4E-3147120IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MKEPKPPAAK GPAVPASSAA AVVPSASPLK RPRTGPGGAN GPQCPSCAVD GCKADLSKGR  60
DYHRRHKVCE AHSKTPTVVV AGREMRFCQQ CSRFHLLAEF DEAKRSCRKR LDGHNRRRRK  120
PQPDNMNSGS FMTTQQGARF SSFVAPRPEP SWSGIIKSED TSYYAHQVLS NRPLFAGCTS  180
TYSKEGRRFP FLQDGDQVSF GTGGAASLEV ATVCQPLLQT VAAAPPPKSS SSNKIFSPDG  240
FTPVLDSDCA LSLLSSPANS SSVDVSRMVQ TAEHIPMAQP LVPSLQQFGS SPSWFSQAAS  300
SGVVVSTAGF ACPSMESEQM NPVLVPSSDG HEMNYHGIFH VGGEGSSDGT SPPLPLSDNR  360
PQTRLWRERQ QSLPAAIRWA LAEGPRLRRV TCYPGDGRES LELEKWGFAR LPAAVKRTKA  420
PCRAEPETAT RASTAYARRG SIVAAGGPEP SILDAIKHSC TSRAPRRRHC GLRVARTGDA  480
RVVPARRVRF ASSPRYMTPW RLRADRSYEE GVHGALAVAR GSCTVGALRP LARLDEIHGD  540
GAHAKADAPR HTAAVRPLQS PGRHHVRPPA LWSPAPDGRA DKTGAPPSRP AVRSSTALPP  600
SASLVSWPSR VASSVRSESS TVDTWRGSMI ARGQYDVPPH HARARSRRSS ASSHTPACVV  660
TGRNIQRRRG TNGSGPAACR PCFAGTLWDP YRPLVSDGGR RRVREQLGSR LLPLRYTTQG  720
WDGMEEEKVS RLIQTGELRP VCSNNGKQHL ASSRTEPERQ RRRLVACEYV RADHGTGLGF  780
RPLGFRVAHH LTQNGKERSV PITPHPFRPA FLTPRRRAIP TRFFCPRLLR SPFLLPFRFA  840
FAALL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-2835120184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103120KRSCRKRLDGHNRRRRKP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795