PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00441.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 140aa    MW: 15396.5 Da    PI: 9.211
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00441.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM50.47.2e-1694139147
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdL 47 
                                   +p+GfrFhPtd+el+ +yLkkk+  +k++l evi+evd++k+ePw+L
  Zmw_sc00441.1.g00160.1.am.mk  94 VPRGFRFHPTDKELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWEL 139
                                   589***************************.99*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-1684139IPR003441NAC domain
PROSITE profilePS5100518.7594140IPR003441NAC domain
PfamPF023653.3E-695117IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MLPEEKRREE KRGEDGISHP SIPADASSRR SRSWPCLASY ATKLVLSPSA AVAAGAAVNS  60
SPCPPPSSCS AGLRSYWGRG GVLTMAAFSS SNGVPRGFRF HPTDKELLLY YLKKKIGFEK  120
FDLEVIREVD LNKIEPWELN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148451121