PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00441.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 301aa    MW: 32661.8 Da    PI: 6.5074
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00441.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM101.41.2e-31148755129
                           NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                   ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + + +++g++k+Lvfy+grap+g+ktdW+mheyrle
  Zmw_sc00441.1.g00150.1.am.mk  14 QNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKCIRT-SYSKIGMRKMLVFYRGRAPHGQKTDWIMHEYRLE 87 
                                   67*************************************9.8889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.7271128IPR003441NAC domain
PfamPF023654.2E-151386IPR003441NAC domain
SuperFamilySSF1019413.79E-3514128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MEHAERCRIG SAPQNEWYFF SHKDRKYPTG SRTNRATTAG FWKATGRDKC IRTSYSKIGM  60
RKMLVFYRGR APHGQKTDWI MHEYRLEEAD DAQGGTGVSE ALPTDPSPDD GASSVQEDGW  120
VVCRVFKKKC FFKIGGGGEG STRQGADAGD HLAVSPPLGS HTHQGALASH YMHPHHQYYH  180
AAASSYYSQM QVPAAYTHQI QVQDLLTNQR PTADAGYDDF SGLPVDHPAA GGLDVGSSDG  240
VAATDGGQLG EGNRDEASGA AEQQWQAIDG FDSRAGSAAV EQMTVRAGQR GGEMDLWGYG  300
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-321412970166NO APICAL MERISTEM PROTEIN
1ut4_B8e-321412970166NO APICAL MERISTEM PROTEIN
1ut7_A8e-321412970166NO APICAL MERISTEM PROTEIN
1ut7_B8e-321412970166NO APICAL MERISTEM PROTEIN
3swm_A8e-321412973169NAC domain-containing protein 19
3swm_B8e-321412973169NAC domain-containing protein 19
3swm_C8e-321412973169NAC domain-containing protein 19
3swm_D8e-321412973169NAC domain-containing protein 19
3swp_A8e-321412973169NAC domain-containing protein 19
3swp_B8e-321412973169NAC domain-containing protein 19
3swp_C8e-321412973169NAC domain-containing protein 19
3swp_D8e-321412973169NAC domain-containing protein 19
4dul_A8e-321412970166NAC domain-containing protein 19
4dul_B8e-321412970166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824150.11e-147protein BEARSKIN1-like
TrEMBLA0A2T7CVD31e-146A0A2T7CVD3_9POAL; Uncharacterized protein
STRINGPavir.Gb01599.1.p1e-147(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046