PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00428.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 527aa    MW: 57241.6 Da    PI: 8.3444
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00428.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.7e-52111361128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeel+++yL++kv++  + +  ++ e+d++k+ePw+Lp+ +k +ekewyfF+ +d+ky+tg r+nrat++g
  Zmw_sc00428.1.g00060.1.am.mk  11 LPPGFRFHPTDEELITHYLARKVADPCFAA-LAVGEADLNKSEPWELPSLAKMGEKEWYFFCLKDRKYPTGLRTNRATEAG 90 
                                   79***********************99888.67***************8888899************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkdk++++ ++ lvg kktLvfy+grapkgek+ Wvmheyrl
  Zmw_sc00428.1.g00060.1.am.mk  91 YWKATGKDKDIFR-GKVLVGSKKTLVFYTGRAPKGEKSGWVMHEYRL 136
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-626161IPR003441NAC domain
PROSITE profilePS5100558.01811161IPR003441NAC domain
PfamPF023652.1E-2812136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MEQELHQPME LPPGFRFHPT DEELITHYLA RKVADPCFAA LAVGEADLNK SEPWELPSLA  60
KMGEKEWYFF CLKDRKYPTG LRTNRATEAG YWKATGKDKD IFRGKVLVGS KKTLVFYTGR  120
APKGEKSGWV MHEYRLHGKP VNGVPRALSK NEWVLCRVFK KSLPGLAPLL AAAAAAKKGA  180
GEMARMDDMV LAHLPPLMDM SGSATVNPEA AHVTCFSNAL EGQFFNHTVP QTAANSGTDD  240
HLGLASSPFF PQYGQLHQGV SLVQLLESNG YDVGLADDEG KPSGLAPPPC KQGERERLSA  300
SQDTGLTSDV NAEISSSYGP KFDQDRLWGY WQSRTVNTNA RSRGRHSQTP KPPAELDSDA  360
SSLATPALEL VGFDPGPDET SYSLHACLSR QCRATRRRRP PTGLIDGGSS ARGAGASRVA  420
VSWNRSFLDG AGSRKGEPID QRWLARAIDD SNGARRANGA GPPAPPPASG SFKNSGIAFC  480
LVCPYLPDIF ASGIQLAAAD CLRTGAGHEL RFDMVSSDRR LHIYFRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-50916118168NAC domain-containing protein 19
3swm_B8e-50916118168NAC domain-containing protein 19
3swm_C8e-50916118168NAC domain-containing protein 19
3swm_D8e-50916118168NAC domain-containing protein 19
3swp_A8e-50916118168NAC domain-containing protein 19
3swp_B8e-50916118168NAC domain-containing protein 19
3swp_C8e-50916118168NAC domain-containing protein 19
3swp_D8e-50916118168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975858.11e-158NAC domain-containing protein 92 isoform X1
SwissprotQ9FLJ21e-89NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A3G1VCF20.0A0A3G1VCF2_9POAL; NAC domain transcription factor
STRINGPavir.Gb01850.1.p1e-158(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]