PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00426.1.g00400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 237aa    MW: 26104.7 Da    PI: 11.7864
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00426.1.g00400.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.74e-11109154449
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                                    kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++
  Zmw_sc00426.1.g00400.1.am.mk 109 PKRVKRILANRQSAQRSRVRKLQYISELERSVTSLQMEVSALSPRV 154
                                   5999********************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-13106170IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634108164IPR004827Basic-leucine zipper domain
PfamPF001706.3E-10110159IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.7E-14110164No hitNo description
SuperFamilySSF579591.48E-11110164No hitNo description
CDDcd147032.97E-19111161No hitNo description
PROSITE patternPS000360113128IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MPPPTYTPAQ PASTLAGWIH LCKARTALGQ DSSGGSGARW QRRERRASKK WRICRRGLPA  60
RGRGRRTPGR RRASSTAEAQ LMDVGDAEDM SPAGARAAAQ ATADGAADPK RVKRILANRQ  120
SAQRSRVRKL QYISELERSV TSLQMEVSAL SPRVAFLDHQ RSLLTVGNSH LKQRIAALAQ  180
DKIFKDAHQE ALKKEIERLR QLYHQQQIKA TGGAERATAA STQARQELLV CEGAAIR
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By white light. {ECO:0000269|PubMed:18065552}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828193.12e-91basic leucine zipper 19-like
SwissprotQ6K3R94e-80BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0A9FPX75e-93A0A0A9FPX7_ARUDO; Uncharacterized protein
STRINGPavir.Ab01112.1.p3e-89(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125