PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00420.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 317aa    MW: 36554.2 Da    PI: 8.4021
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00420.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.94.8e-5461331128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePwdL  k  + ++++ewyfF +rd+ky++g r+nrat+
  Zmw_sc00420.1.g00180.1.am.mk   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWDLAeKsFLPGTDSEWYFFGPRDRKYPNGCRTNRATR 85 
                                   79****************************.99**************84334555788*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWk+tgkd++v   +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  Zmw_sc00420.1.g00180.1.am.mk  86 AGYWKSTGKDRRVSY-QNRSIGMKKTLVYYKGRAPQGLRTNWVMHEYRI 133
                                   **************9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-634156IPR003441NAC domain
PROSITE profilePS5100559.4236156IPR003441NAC domain
PfamPF023651.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWD LAEKSFLPGT  60
DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRVSY QNRSIGMKKT LVYYKGRAPQ  120
GLRTNWVMHE YRIEESECDN TMGIQDSYAL CRVFKKNVAV GESEKQAECS TSKAKGNQER  180
LTNFGDVRET SVDRAAKQNP RACSVAVAIR RRRAPPFTHL GSDRWRTDHC LDEEHEWTPG  240
RARDLTPLQR FPHEQRHKCL APSLVLDEMP EPEEGLEAWR PHLCWNTPLA LTVGTSRLQI  300
LQSRCRIEDA GLNSPNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-54615717166NO APICAL MERISTEM PROTEIN
1ut4_B5e-54615717166NO APICAL MERISTEM PROTEIN
1ut7_A5e-54615717166NO APICAL MERISTEM PROTEIN
1ut7_B5e-54615717166NO APICAL MERISTEM PROTEIN
4dul_A5e-54615717166NAC domain-containing protein 19
4dul_B5e-54615717166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008653036.11e-122NAC domain-containing protein 45
SwissprotQ9FFI52e-85NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0A9HWW61e-128A0A0A9HWW6_ARUDO; NAC017
STRINGLPERR09G14720.11e-124(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]