PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00420.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 327aa    MW: 36689.1 Da    PI: 6.2454
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00420.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.38.7e-55882161128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat+
  Zmw_sc00420.1.g00160.1.am.mk  88 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATR 167
                                   79****************************.99**************85335566888*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWk+tgkd++vl+++g+ +g+kktLv+y+grap+g++tdWvmheyrl
  Zmw_sc00420.1.g00160.1.am.mk 168 AGYWKSTGKDRRVLHHGGRPIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 216
                                   ***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-6581239IPR003441NAC domain
PROSITE profilePS5100560.25188239IPR003441NAC domain
PfamPF023651.9E-2989216IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAYLLKLEEL DLDDGERVSR AGGAHLIRLR CVSAQREAEQ ARYLCHQLAS LCASPTTGGQ  60
LGCGTTTTSR PGHHRRRSET SMAARAGLPP GFRFHPTDEE LVNYYLKRKI HGLKIELDII  120
PEVDLYKCEP WELADKSFLP SRDPEWYFFG PRDRKYPNGF RTNRATRAGY WKSTGKDRRV  180
LHHGGRPIGM KKTLVYYRGR APQGVRTDWV MHEYRLDDKD AEDTLPIQDT YALCRVFKKN  240
AICTEVDDLQ AQCSMALLEG ARQQLLPSGS QEYETLSPDV PVGSTSGGAD EDADKDDSWM  300
QFISDDAWCS STADGAEEST SCVALAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-53722411167NO APICAL MERISTEM PROTEIN
1ut4_B7e-53722411167NO APICAL MERISTEM PROTEIN
1ut7_A7e-53722411167NO APICAL MERISTEM PROTEIN
1ut7_B7e-53722411167NO APICAL MERISTEM PROTEIN
4dul_A7e-53722411167NAC domain-containing protein 19
4dul_B7e-53722411167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803496.11e-174NAC domain-containing protein 86-like
SwissprotQ9FFI57e-78NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A2S3H2331e-173A0A2S3H233_9POAL; Uncharacterized protein
TrEMBLA0A2T7EVM31e-173A0A2T7EVM3_9POAL; Uncharacterized protein
STRINGPavir.Bb02627.1.p1e-172(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]