PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00409.1.g00370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 748aa    MW: 82757.5 Da    PI: 4.7891
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00409.1.g00370.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-535076351128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeelv++yLk+k++g ++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat+
  Zmw_sc00409.1.g00370.1.am.mk 507 LPPGFRFHPTDEELVNYYLKRKIHGLEIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATR 586
                                   79****************************.99**************85335566888*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWk+tgkd++vl+++g+ +g+kktLv+y+grap+g++t Wvmheyrl
  Zmw_sc00409.1.g00370.1.am.mk 587 AGYWKSTGKDRRVLHHGGRRIGMKKTLVYYRGRAPQGVRTGWVMHEYRL 635
                                   ***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF034785.1E-6315350IPR005174Domain unknown function DUF295
SuperFamilySSF1019414.45E-64500658IPR003441NAC domain
PROSITE profilePS5100560.323507658IPR003441NAC domain
PfamPF023655.3E-29508635IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MAQEQARLGW SSGLPEPEIL ESIGKGLASG HDAASFRSAC VSWRAALPFK SFAPLLLLPF  60
GPESESVTFY SVSEEEIDSK PLPDDVRGRE PCGASRGWLA LMDEAASVML LNPFTGARVE  120
LPPADEHAAA ASSGTRVSKV DGRWVLLPDD GYGNAEAVRV INLEEMRDVF IREIVLSAPP  180
YAGRECIAMA VLPNSTMVAF CRVGVDSAWT LLDTNLECSV ACIVHCQERI FAVDITGDIS  240
ICNFNTGAGA PPTATPLPSL SAPEGVCNRS YLESNGELHI VGVMVTTFHE TKTFTSNIVV  300
YKCDFLLDQT PVWSKVDDIG DMTLLVSKDF SESFGGASVS KYKKNSIYFS EALYGDPKIS  360
AIRYEIVDIA TETREVVHVN GNMDPLEALC WFRPNIWMGA ELARYKYDEE EDSTKETDVI  420
KIKGAWTIKS SRGEAGGPPD RWSPWESVLI RLSVRQCPKR SGASKVSFFA ISFLSATADV  480
QPVRHQYVVR SPPPTLRERY MAARAGLPPG FRFHPTDEEL VNYYLKRKIH GLEIELDIIP  540
EVDLYKCEPW ELADKSFLPS RDPEWYFFGP RDRKYPNGFR TNRATRAGYW KSTGKDRRVL  600
HHGGRRIGMK KTLVYYRGRA PQGVRTGWVM HEYRLDDKDA EDTMPMQDTY ALCRVFKKNA  660
ICTEVDDLQA AQCNMALLEG ACQQLLPSGS QEYETPSPDV PVGSTSGGAD VEDADKDDSW  720
MQFISDDAWC SSSADGAEES ASCVALAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-4950766017167NO APICAL MERISTEM PROTEIN
1ut4_B5e-4950766017167NO APICAL MERISTEM PROTEIN
1ut7_A5e-4950766017167NO APICAL MERISTEM PROTEIN
1ut7_B5e-4950766017167NO APICAL MERISTEM PROTEIN
3swm_A4e-4950766020170NAC domain-containing protein 19
3swm_B4e-4950766020170NAC domain-containing protein 19
3swm_C4e-4950766020170NAC domain-containing protein 19
3swm_D4e-4950766020170NAC domain-containing protein 19
3swp_A4e-4950766020170NAC domain-containing protein 19
3swp_B4e-4950766020170NAC domain-containing protein 19
3swp_C4e-4950766020170NAC domain-containing protein 19
3swp_D4e-4950766020170NAC domain-containing protein 19
4dul_A5e-4950766017167NAC domain-containing protein 19
4dul_B5e-4950766017167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025815544.11e-170F-box protein SKIP23-like
TrEMBLA0A2S3HVM31e-168A0A2S3HVM3_9POAL; Uncharacterized protein
STRINGPavir.Ea01294.1.p1e-164(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP542822