PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00408.1.g00390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 325aa    MW: 37246.6 Da    PI: 6.3846
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00408.1.g00390.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.7e-26123169147
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47 
                                   krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +
  Zmw_sc00408.1.g00390.1.am.mk 123 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYH 169
                                   79******************************************976 PP

2K-box58.52.9e-20178245168
                         K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRsk 68 
                                   yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+sL+++eL+ Leq+++ +lk+++  
  Zmw_sc00408.1.g00390.1.am.mk 178 YQQTVGNSLWVEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFEELRALEQNVDVALKEVKHS 245
                                   7899999**********************************************************864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.333115175IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-37115174IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-31116202IPR002100Transcription factor, MADS-box
CDDcd002653.14E-39116187No hitNo description
PRINTSPR004045.9E-26117137IPR002100Transcription factor, MADS-box
PfamPF003195.3E-23124169IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-26137152IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-26152173IPR002100Transcription factor, MADS-box
PfamPF014861.7E-12189245IPR002487Transcription factor, K-box
PROSITE profilePS512979.52191276IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTSAAHARWE WGLDDSQWIE LLDERDDRQA SLPRRDRQRR AADRPTDRPA DRSRCEATQR  60
PYRAALGWFS HAHAHWPRER VTVLAGLAWH GAPLFHEEEE EDKLAGTAED LEKKMGRGKI  120
EIKRIENATN RQVTYSKRRT GIMKKARELT VLCDAQVAII MFSSTGKYHD IKTIFDRYQQ  180
TVGNSLWVEQ YENMQRTLSH LKDINRNLRT EIRQRMGEDL DSLEFEELRA LEQNVDVALK  240
EVKHSYEAYK NLQQELTHES SSEDVFVQGM REEPAYGFVD NTGAGWDGAV ALGGGAAADM  300
YALRVVPSQP NLHGVAYGSH DLRLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12739RQASLPRRDRQRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966424.11e-120PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-106MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLK3XZ631e-120K3XZ63_SETIT; Uncharacterized protein
STRINGSi007221m1e-120(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552