PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00400.1.g00450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 358aa    MW: 39096.8 Da    PI: 8.1036
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00400.1.g00450.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.2e-51271591128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+ +yL+k++ + ++++ +vi+evdiyk++PwdLp+k+  ++ ewyfFs+rd+ky++g r+nra+ 
  Zmw_sc00400.1.g00450.1.sm.mkhc  27 LPPGFRFHPTDEELILHYLRKRAGAVSCPA-RVIAEVDIYKLDPWDLPAKAVFGDGEWYFFSPRDRKYPNGVRPNRAAG 104
                                     79***************************9.99***************87778999*********************** PP

                             NAM  80 sgyWkatgkdkevlsk......kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWkatg+dk+++++      +g+ +g+kk Lvfy+gr pkg kt+W+mheyrl
  Zmw_sc00400.1.g00450.1.sm.mkhc 105 SGYWKATGTDKPITHSaasvsnRGAMIGVKKALVFYRGRPPKGMKTSWIMHEYRL 159
                                     ***************98888877778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6323192IPR003441NAC domain
PROSITE profilePS5100560.39527192IPR003441NAC domain
PfamPF023651.8E-2628159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTIEFALGEA PSSSSSFAGG GMPPTPLPPG FRFHPTDEEL ILHYLRKRAG AVSCPARVIA  60
EVDIYKLDPW DLPAKAVFGD GEWYFFSPRD RKYPNGVRPN RAAGSGYWKA TGTDKPITHS  120
AASVSNRGAM IGVKKALVFY RGRPPKGMKT SWIMHEYRLA DTLNAANTYC PARFKNASMR  180
LDDWVLCRIY KKTNPQLTYS SSPPLDAEEN YSMDGGLGHG HGQYQQDASI SAANDVAGRL  240
QLPRPPSISD YLVDYSAVSE MFESIPAPRF GTADTGSSSG PAAAHQFLVG NNSELASGSS  300
VAQQSSHNRR LMEDHSNPNM EMLQHSSNKR VLSDHASMAI NDSFSLFGPG FPSLQDRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-702719217165NO APICAL MERISTEM PROTEIN
1ut4_B6e-702719217165NO APICAL MERISTEM PROTEIN
1ut7_A6e-702719217165NO APICAL MERISTEM PROTEIN
1ut7_B6e-702719217165NO APICAL MERISTEM PROTEIN
3swm_A6e-702719220168NAC domain-containing protein 19
3swm_B6e-702719220168NAC domain-containing protein 19
3swm_C6e-702719220168NAC domain-containing protein 19
3swm_D6e-702719220168NAC domain-containing protein 19
3swp_A6e-702719220168NAC domain-containing protein 19
3swp_B6e-702719220168NAC domain-containing protein 19
3swp_C6e-702719220168NAC domain-containing protein 19
3swp_D6e-702719220168NAC domain-containing protein 19
4dul_A6e-702719217165NAC domain-containing protein 19
4dul_B6e-702719217165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967928.11e-141NAC domain-containing protein 18
TrEMBLA0A368R2211e-140A0A368R221_SETIT; Uncharacterized protein
STRINGPavir.Ea00837.1.p1e-130(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123